Property Summary

Ligand Count 3
NCBI Gene PubMed Count 7
PubMed Score 7.43
PubTator Score 7.45

Knowledge Summary

Patent (1,898)

TINX Plot

  Disease (2)

Expression

Gene RIF (3)

AA Sequence

MEPRCPPPCGCCERLVLNVAGLRFETRARTLGRFPDTLLGDPARRGRFYDDARREYFFDRHRPSFDAVLY      1 - 70
YYQSGGRLRRPAHVPLDVFLEEVAFYGLGAAALARLREDEGCPVPPERPLPRRAFARQLWLLFEFPESSQ     71 - 140
AARVLAVVSVLVILVSIVVFCLETLPDFRDDRDGTGLAAAAAAGPFPAPLNGSSQMPGNPPRLPFNDPFF    141 - 210
VVETLCICWFSFELLVRLLVCPSKAIFFKNVMNLIDFVAILPYFVALGTELARQRGVGQQAMSLAILRVI    211 - 280
RLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFSSAVYFAEVDRVDSHFTSIPESFW    281 - 350
WAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTISLPVPVIVSNFSYFYHRETEGEEAGMFSHVDMQP    351 - 420
CGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV                                      421 - 456
//

Text Mined References (7)

PMID Year Title