Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.71
PubTator Score 7.45

Knowledge Summary

Patent (1,898)

TINX Plot

  Disease Relevance (2)

Expression

Gene RIF (3)

PMID Text
22438204 The authors conclude that K(v) 1.7 contributes to the membrane-repolarizing current of beta cells during glucose-stimulated insulin.
15639836 Observational study of genotype prevalence. (HuGE Navigator)
11896454 Expressed in heart, but not the cause of progressive familial heart block I.

AA Sequence

MEPRCPPPCGCCERLVLNVAGLRFETRARTLGRFPDTLLGDPARRGRFYDDARREYFFDRHRPSFDAVLY      1 - 70
YYQSGGRLRRPAHVPLDVFLEEVAFYGLGAAALARLREDEGCPVPPERPLPRRAFARQLWLLFEFPESSQ     71 - 140
AARVLAVVSVLVILVSIVVFCLETLPDFRDDRDGTGLAAAAAAGPFPAPLNGSSQMPGNPPRLPFNDPFF    141 - 210
VVETLCICWFSFELLVRLLVCPSKAIFFKNVMNLIDFVAILPYFVALGTELARQRGVGQQAMSLAILRVI    211 - 280
RLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFSSAVYFAEVDRVDSHFTSIPESFW    281 - 350
WAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTISLPVPVIVSNFSYFYHRETEGEEAGMFSHVDMQP    351 - 420
CGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV                                      421 - 456
//

Publication (7)

PMID Year Title
22438204 2012 Block of Kv1.7 potassium currents increases glucose-stimulated insulin secretion.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15639836 2003 [Distribution and significance of cSNP in KCNA7 gene as a novel NIDDM candidate gene in the population of northeast China].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11896454 2002 Characterisation of the human voltage-gated potassium channel gene, KCNA7, a candidate gene for inherited cardiac disorders, and its exclusion as cause of progressive familial heart block I (PFHBI).
11368907 2001 Initial isolation and analysis of the human Kv1.7 (KCNA7) gene, a member of the voltage-gated potassium channel gene family.
9488722 1998 Genomic organization, chromosomal localization, tissue distribution, and biophysical characterization of a novel mammalian Shaker-related voltage-gated potassium channel, Kv1.7.