Property Summary

NCBI Gene PubMed Count 11
PubMed Score 3.06
PubTator Score 3.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma 1.700 4.2e-05
Astrocytoma, Pilocytic 1.600 6.7e-08
glioblastoma 1.400 3.8e-08
lung cancer -1.100 3.0e-03
non primary Sjogren syndrome sicca 1.100 1.4e-02
ovarian cancer 1.100 4.8e-04
primitive neuroectodermal tumor 1.300 3.8e-04
psoriasis -2.200 1.4e-05
subependymal giant cell astrocytoma 1.060 2.2e-02

Gene RIF (3)

AA Sequence

MGPLSPARTLRLWGPRSLGVALGVFMTIGFALQLLGGPFQRRLPGLQLRQPSAPSLRPALPSCPPRQRLV      1 - 70
FLKTHKSGSSSVLSLLHRYGDQHGLRFALPARYQFGYPKLFQASRVKGYRPQGGGTQLPFHILCHHMRFN     71 - 140
LKEVLQVMPSDSFFFSIVRDPAALARSAFSYYKSTSSAFRKSPSLAAFLANPRGFYRPGARGDHYARNLL    141 - 210
WFDFGLPFPPEKRAKRGNIHPPRDPNPPQLQVLPSGAGPRAQTLNPNALIHPVSTVTDHRSQISSPASFD    211 - 280
LGSSSFIQWGLAWLDSVFDLVMVAEYFDESLVLLADALCWGLDDVVGFMHNAQAGHKQGLSTVSNSGLTA    281 - 350
EDRQLTARARAWNNLDWALYVHFNRSLWARIEKYGQGRLQTAVAELRARREALAKHCLVGGEASDPKYIT    351 - 420
DRRFRPFQFGSAKVLGYILRSGLSPQDQEECERLATPELQYKDKLDAKQFPPTVSLPLKTSRPLSP        421 - 486
//

Text Mined References (13)

PMID Year Title