Property Summary

NCBI Gene PubMed Count 30
Grant Count 81
R01 Count 30
Funding $8,003,847.74
PubMed Score 123.46
PubTator Score 60.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q96RP3 Q9BUG0
Symbols UR
SRP
URP
UCNI
UCN-II

Gene

PDB

2RMG   3N95  

Gene RIF (21)

PMID Text
26168276 The transcripts of TAS1R3 and UCN2 in peripheral blood cells may be considered potential biomarkers of consumption of sugary and fatty food, respectively, to complement data of food-intake questionnaires.
25426872 up-regulated in placenta, fetal membranes, and myometrium in labor
24835211 Corticotrophin-Releasing Factor (CRF) and the urocortins are potent regulators of the inflammatory phenotype of human and mouse white adipocytes.
24291344 Solubilized SUMO-eXact-preproUCN2 was used successfully to generate two high affinity mouse monoclonal antibodies specific to the pro-region of urocortin 2.
24249730 UCNII caused cell death via different membrane-disrupting mechanisms that involve aggregation & membrane depolarization in bacteria and pore formation in Leishmania even inside macrophages. Innate immune cells produce UCNII in response to infections.
24107226 UCN2 is significantly associated with AAA and inhibits VSMC proliferation by inducing a G1 cell cycle arrest suggesting a plausible regulatory role in AAA pathogenesis
23850799 Stresscopin-related peptide induces a weaker enhancement of cardiovascular function through corticotropin-releasing factor receptorn 2 than that induced by stresscopin.
23493376 Description of ucn2 posttranslational processing and peptide sequence. Hypoxia and glycosylation, paradigms that might influence secretion or processing of gene products, did not significantly impact hUcn 2 prohormone cleavage.
22000474 study showed that Ucn2 and Ucn3 differentially regulate the LPS-induced TNF-alpha and IL-10 expression and secretion in trophoblast explants acting through CRH-R2. Ucn2 is proinflammatory.
21454316 These data suggest a possible involvement of urocortin 2 and Ucn 3 in the mechanisms of endometriosis.
More...

AA Sequence

MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGS      1 - 70
RIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC                                 71 - 112
//

Publication (32)

PMID Year Title
26168276 2015 TAS1R3 and UCN2 Transcript Levels in Blood Cells Are Associated With Sugary and Fatty Food Consumption in Children.
25426872 2015 Urocortin 2 role in placental and myometrial inflammatory mechanisms at parturition.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
24835211 2014 Corticotrophin-Releasing Factor (CRF) and the urocortins are potent regulators of the inflammatory phenotype of human and mouse white adipocytes and the differentiation of mouse 3T3L1 pre-adipocytes.
24291344 2014 A His6-SUMO-eXact tag for producing human prepro-urocortin 2 in Escherichia coli for raising monoclonal antibodies.
24249730 2013 Protective role of the neuropeptide urocortin II against experimental sepsis and leishmaniasis by direct killing of pathogens.
24107226 2014 Urocortin 2 is associated with abdominal aortic aneurysm and mediates anti-proliferative effects on vascular smooth muscle cells via corticotrophin releasing factor receptor 2.
23850799 2013 Intracerebroventricular injection of stresscopin-related peptide enhances cardiovascular function in conscious rats.
23493376 2013 Posttranslational processing of human and mouse urocortin 2: characterization and bioactivity of gene products.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
More...