Property Summary

NCBI Gene PubMed Count 32
PubMed Score 129.73
PubTator Score 60.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Anorexia 43 0.0 0.0
Heart failure 162 0.0 0.0
Disease Target Count Z-score Confidence
chronic kidney disease 90 3.971 2.0

Expression

Synonym

Accession Q96RP3 Q9BUG0
Symbols UR
SRP
URP
UCNI
UCN-II

Gene

PDB

2RMG   3N95  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (23)

AA Sequence

MTRCALLLLMVLMLGRVLVVPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGS      1 - 70
RIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC                                 71 - 112
//

Text Mined References (34)

PMID Year Title