Property Summary

NCBI Gene PubMed Count 30
Grant Count 23
R01 Count 19
Funding $2,165,215.76
PubMed Score 37.75
PubTator Score 23.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.200 0.001
ovarian cancer 1.200 0.000

Gene RIF (15)

PMID Text
26457685 MED15 as a potential biomarker for head and neck squamous cell carcinoma
26377566 MED15 is differentially expressed in tumor-free testis and testicular germ cell tumors
25791637 MED15 overexpression is a clonal event during head and neck squamous cell carcinoma progression.
24374838 these findings implicate MED15 in CRPC, and as MED15 is evolutionary conserved, it is likely to emerge as a lethal phenotype in other therapeutic-resistant diseases, and not restricted to our disease model.
22916034 MED15 and PUM1 proteins with coiled-coil domains are potent enhancers of polyQ-mediated ataxin-1 protein misfolding and proteotoxicity in vitro and in vivo.
20025940 The data identify PC2 as a novel PLAGL2-binding protein and important mediator of PLAGL2 transactivation.
18854154 Knockdown of mediator complex subunit 15 (MED15) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16904669 results suggest that TRIM11, with the ubiquitin-proteasome pathway, regulates ARC105 function in TGFbeta signaling
16799563 SREBPs use the evolutionarily conserved ARC105 (also called MED15) subunit to activate target genes
15455391 TIG1 gene Silencing by promoter hypermethylation is associated with nasopharyngeal carcinoma
More...

AA Sequence

MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIH      1 - 70
NKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQPPPGTSGMAPHS     71 - 140
MAVVSTATPQTQLQLQQVALQQQQQQQQFQQQQQAALQQQQQQQQQQQFQAQQSAMQQQFQAVVQQQQQL    141 - 210
QQQQQQQQHLIKLHHQNQQQIQQQQQQLQRIAQLQLQQQQQQQQQQQQQQQQALQAQPPIQQPPMQQPQP    211 - 280
PPSQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVRA    281 - 350
PMVVQQPPVQPQVQQQQTAVQTAQAAQMVAPGVQMITEALAQGGMHIRARFPPTTAVSAIPSSSIPLGRQ    351 - 420
PMAQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPSSQPNSNVSSGPAPSPSSFLPSPSPQPSQ    421 - 490
SPVTARTPQNFSVPSPGPLNTPVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRK    491 - 560
KDLSKMKSLLDILTDPSKRCPLKTLQKCEIALEKLKNDMAVPTPPPPPVPPTKQQYLCQPLLDAVLANIR    561 - 630
SPVFNHSLYRTFVPAMTAIHGPPITAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSN    631 - 700
NGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVT    701 - 770
ALLNTWAQSVHQACLSAA                                                        771 - 788
//

Text Mined References (37)

PMID Year Title
26457685 2015 MED15: a potential biomarker for head and neck squamous cell carcinoma?
26377566 2015 Differential expression of Mediator complex subunit MED15 in testicular germ cell tumors.
25791637 2015 Clinical and molecular implications of MED15 in head and neck squamous cell carcinoma.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
24374838 2014 MED15, encoding a subunit of the mediator complex, is overexpressed at high frequency in castration-resistant prostate cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22916034 2012 Identification of human proteins that modify misfolding and proteotoxicity of pathogenic ataxin-1.
21269460 2011 Initial characterization of the human central proteome.
20025940 2010 Modulation of PLAGL2 transactivation by positive cofactor 2 (PC2), a component of the ARC/Mediator complex.
More...