Property Summary

NCBI Gene PubMed Count 7
Grant Count 1
Funding $11,285.71
PubMed Score 0.31
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 8.400 0.000

Gene RIF (2)

PMID Text
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 upregulates the expression of small proline-rich protein 2F (SPRR2F) in peptide-treated PBMCs
18643845 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.

AA Sequence

MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPK      1 - 70
SK                                                                         71 - 72
//

Text Mined References (7)

PMID Year Title
18643845 2009 Association of psoriasis to PGLYRP and SPRR genes at PSORS4 locus on 1q shows heterogeneity between Finnish, Swedish and Irish families.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15232223 2004 Estrogen regulates the expression of the small proline-rich 2 gene family in the mouse uterus.
11279051 2001 Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function.
9888996 1999 Mouse Sprr2 genes: a clustered family of genes showing differential expression in epithelial tissues.
8340374 1993 Secretion of disulfide-linked human T-cell receptor gamma delta heterodimers.
8325635 1993 Molecular characterization and evolution of the SPRR family of keratinocyte differentiation markers encoding small proline-rich proteins.