Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.31
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 3.1e-199

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 8.400 3.1e-199

Gene RIF (2)

AA Sequence

MSYQQQQCKQPCQPPPVCPAPKCPEPCPPPKCPEPCPPSKCPQSCPPQQCQQKCPPVTPSPPCQPKCPPK      1 - 70
SK                                                                         71 - 72
//

Text Mined References (7)

PMID Year Title