Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.00
PubTator Score 10.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
gastric carcinoma 807 1.3e-02

Expression

  Differential Expression (1)

Disease log2 FC p
gastric carcinoma -2.400 1.3e-02

 GO Function (1)

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (7)

AA Sequence

MVPGQAQPQSPEMLLLPLLLPVLGAGSLNKDPSYSLQVQRQVPVPEGLCVIVSCNLSYPRDGWDESTAAY      1 - 70
GYWFKGRTSPKTGAPVATNNQSREVEMSTRDRFQLTGDPGKGSCSLVIRDAQREDEAWYFFRVERGSRVR     71 - 140
HSFLSNAFFLKVTALTKKPDVYIPETLEPGQPVTVICVFNWAFKKCPAPSFSWTGAALSPRRTRPSTSHF    141 - 210
SVLSFTPSPQDHDTDLTCHVDFSRKGVSAQRTVRLRVAYAPKDLIISISHDNTSALELQGNVIYLEVQKG    211 - 280
QFLRLLCAADSQPPATLSWVLQDRVLSSSHPWGPRTLGLELRGVRAGDSGRYTCRAENRLGSQQQALDLS    281 - 350
VQYPPENLRVMVSQANRTVLENLGNGTSLPVLEGQSLRLVCVTHSSPPARLSWTRWGQTVGPSQPSDPGV    351 - 420
LELPPIQMEHEGEFTCHAQHPLGSQHVSLSLSVHYPPQLLGPSCSWEAEGLHCSCSSQASPAPSLRWWLG    421 - 490
EELLEGNSSQGSFEVTPSSAGPWANSSLSLHGGLSSGLRLRCKAWNVHGAQSGSVFQLLPGKLEHGGGLG    491 - 560
LGAALGAGVAALLAFCSCLVVFRVKICRKEARKRAAAEQDVPSTLGPISQGHQHECSAGSSQDHPPPGAA    561 - 630
TYTPGKGEEQELHYASLSFQGLRLWEPADQEAPSTTEYSEIKIHTGQPLRGPGFGLQLEREMSGMVPK      631 - 698
//

Text Mined References (9)

PMID Year Title