Property Summary

NCBI Gene PubMed Count 55
PubMed Score 49.68
PubTator Score 48.41

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Menopause present (finding) 20
Disease Target Count P-value
ovarian cancer 8492 8.09740582806714E-8
group 3 medulloblastoma 2254 0.0018132336793903
Disease Target Count Z-score Confidence
Breast cancer 3099 3.491 1.7
Fanconi's anemia 50 3.36 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 0.002
ovarian cancer -1.300 0.000

Synonym

Accession Q96RL1 A8MSA1 B3KMZ1 B4E3N2 Q5XKQ1 Q7Z3W7 Q8N5B9 Q9BZR1 Q9BZR5 Q9UHX7
Symbols RAP80
X2HRIP110

Gene

PDB

2MKF   2MKG   2N9E   2RR9  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (40)

PMID Text
26781088 TRAIP/RNF206 is required for recruitment of RAP80 to sites of DNA damage.(
26748910 RAP80 is a critical gatekeeper in impeding epithelial-mesenchymal transition-induced metastasis and malignant phenotypes of cancer as well as preserving DNA integrity.
26719330 Data suggest that RAP80 SIM (SUMO interacting motif) binds SUMO-2; both specificity and affinity are enhanced through phosphorylation of canonical CK2 (casein kinase 2) site within the SIM.
26446986 Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells.
25164908 patients with low RAP80 expression received gemcitabine/cisplatin, those with intermediate/high RAP80 expression and low/intermediate BRCA1 expression received docetaxel/cisplatin
25132264 A new role of FANCG in Homologous recombination repair of interstrand crosslinks through K63Ub-mediated interaction with the Rap80-BRCA1 complex.
24627472 Data indicate that a single point deletion (DeltaE81) in RAP80 abrogates multivalent interactions with polyubiquitin.
23264621 post-translational phosphorylation of RAP80 by the Cdk1-cyclin B(1) complex is important for RAP80 functional sensitivity to IR and G(2)/M checkpoint control.
23211528 connect ubiquitin- and SUMO-dependent DSB recognition, revealing that RNF4-synthesized hybrid SUMO-ubiquitin chains are recognized by RAP80 to promote BRCA1 recruitment and DNA repair.
22792303 Loss of RAP80 abolishes the recruitment of the BRCA1-A complex to DNA lesions in response to DNA damage.
More...

AA Sequence

MPRRKKKVKEVSESRNLEKKDVETTSSVSVKRKRRLEDAFIVISDSDGEEPKEENGLQKTKTKQSNRAKC      1 - 70
LAKRKIAQMTEEEQFALALKMSEQEAREVNSQEEEEEELLRKAIAESLNSCRPSDASATRSRPLATGPSS     71 - 140
QSHQEKTTDSGLTEGIWQLVPPSLFKGSHISQGNEAEEREEPWDHTEKTEEEPVSGSSGSWDQSSQPVFE    141 - 210
NVNVKSFDRCTGHSAEHTQCGKPQESTGRGSAFLKAVQGSGDTSRHCLPTLADAKGLQDTGGTVNYFWGI    211 - 280
PFCPDGVDPNQYTKVILCQLEVYQKSLKMAQRQLLNKKGFGEPVLPRPPSLIQNECGQGEQASEKNECIS    281 - 350
EDMGDEDKEERQESRASDWHSKTKDFQESSIKSLKEKLLLEEEPTTSHGQSSQGIVEETSEEGNSVPASQ    351 - 420
SVAALTSKRSLVLMPESSAEEITVCPETQLSSSETFDLEREVSPGSRDILDGVRIIMADKEVGNKEDAEK    421 - 490
EVAISTFSSSNQVSCPLCDQCFPPTKIERHAMYCNGLMEEDTVLTRRQKEAKTKSDSGTAAQTSLDIDKN    491 - 560
EKCYLCKSLVPFREYQCHVDSCLQLAKADQGDGPEGSGRACSTVEGKWQQRLKNPKEKGHSEGRLLSFLE    561 - 630
QSEHKTSDADIKSSETGAFRVPSPGMEEAGCSREMQSSFTRRDLNESPVKSFVSISEATDCLVDFKKQVT    631 - 700
VQPGSRTRTKAGRGRRRKF                                                       701 - 719
//

Text Mined References (68)

PMID Year Title
26781088 2016 TRAIP/RNF206 is required for recruitment of RAP80 to sites of DNA damage.
26748910 2016 RAP80 regulates epithelial-mesenchymal transition related with metastasis and malignancy of cancer.
26719330 2016 Molecular Basis for Phosphorylation-dependent SUMO Recognition by the DNA Repair Protein RAP80.
26446986 2016 Impaired TIP60-mediated H4K16 acetylation accounts for the aberrant chromatin accumulation of 53BP1 and RAP80 in Fanconi anemia pathway-deficient cells.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25164908 2014 Two biomarker-directed randomized trials in European and Chinese patients with nonsmall-cell lung cancer: the BRCA1-RAP80 Expression Customization (BREC) studies.
25132264 2015 K63-linked ubiquitination of FANCG is required for its association with the Rap80-BRCA1 complex to modulate homologous recombination repair of DNA interstand crosslinks.
24627472 2014 Molecular basis for impaired DNA damage response function associated with the RAP80 ?E81 defect.
More...