Property Summary

NCBI Gene PubMed Count 10
Grant Count 13
R01 Count 13
Funding $1,709,182.18
PubMed Score 12.26
PubTator Score 8.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma -1.200 0.000
inflammatory breast cancer -1.300 0.024
ovarian cancer 1.100 0.000

Gene RIF (8)

PMID Text
26243458 Upregulation of CITED4 is associated with colorectal cancer.
21755341 Demethylation and histone modification can potentially reactivate CITED4 gene expression in some breast cancers and lead to changes in tumour behaviour.
20734064 Observational study of gene-disease association. (HuGE Navigator)
18722883 mutational study of CITED4 in 24 glial tumors (22 primary glioblastomas, 1 low-grade astrocytoma & its recurrent secondary glioblastoma)
17311001 CITED4 is epigenetically silenced in the vast majority of oligodendroglial tumours with 1p and 19q deletions.
15572674 The interaction and functional cooperation between FHL2, CITED4, and CTNNB were studied.
15342390 Results show that breast cancer development is characterized by either nuclear loss or cytoplasmic translocation of CITED4, with consequent loss of hypoxia-inducible factor-1alpha transcriptional antagonist activity.
11744733 CITED4 functions as a transactivator when artificially targeted to a promoter element. CITED4 physically interacts with all TFAP2 isoforms in vitro and strongly co-activates all TFAP2 isoforms in Hep3B cells.

AA Sequence

MADHLMLAEGYRLVQRPPSAAAAHGPHALRTLPPYAGPGLDSGLRPRGAPLGPPPPRQPGALAYGAFGPP      1 - 70
SSFQPFPAVPPPAAGIAHLQPVATPYPGRAAAPPNAPGGPPGPQPAPSAAAPPPPAHALGGMDAELIDEE     71 - 140
ALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC                              141 - 184
//

Publication (10)

PMID Year Title
26243458 2016 CITED4 gene silencing in colorectal cancer cells modulates adherens/tight junction gene expression and reduces cell proliferation.
21755341 2011 Aberrant DNA methylation but not mutation of CITED4 is associated with alteration of HIF-regulated genes in breast cancer.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
18722883 2008 Mutational analysis of the CITED4 gene in glioblastomas.
17311001 2007 Hypermethylation and transcriptional downregulation of the CITED4 gene at 1p34.2 in oligodendroglial tumours with allelic losses on 1p and 19q.
15572674 2004 Interaction and functional cooperation between the LIM protein FHL2, CBP/p300, and beta-catenin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342390 2004 CITED4 inhibits hypoxia-activated transcription in cancer cells, and its cytoplasmic location in breast cancer is associated with elevated expression of tumor cell hypoxia-inducible factor 1alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11744733 2002 Human CREB-binding protein/p300-interacting transactivator with ED-rich tail (CITED) 4, a new member of the CITED family, functions as a co-activator for transcription factor AP-2.