Property Summary

NCBI Gene PubMed Count 79
PubMed Score 288.21
PubTator Score 132.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
ductal carcinoma in situ 2.000 2.3e-02
interstitial cystitis 3.800 1.1e-03
nasopharyngeal carcinoma -2.200 5.0e-04
osteosarcoma -3.329 3.0e-09
primary Sjogren syndrome 3.000 3.1e-05
primitive neuroectodermal tumor 1.400 2.6e-02
sonic hedgehog group medulloblastoma 1.100 1.6e-02
tuberculosis -1.500 4.6e-04
ulcerative colitis 2.200 1.2e-02

Gene RIF (70)

AA Sequence

MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEA      1 - 70
ALPLPGLLFGAPALLGLALVLALVLVGLVSWRRRQRRLRGASSAEAPDGDKDAPEPLDKVIILSPGISDA     71 - 140
TAPAWPPPGEDPGTTPPGHSVPVPATELGSTELVTTKTAGPEQQ                              141 - 184
//

Text Mined References (81)

PMID Year Title