Property Summary

Ligand Count 60
NCBI Gene PubMed Count 23
PubMed Score 308.84
PubTator Score 124.37

Knowledge Summary

Patent (42,640)

Gene RIF (12)

AA Sequence

MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNWLIHSMATVDF      1 - 70
LLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISIDRYYAVCDPLRYKAKMNILVI     71 - 140
CVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRGGCSVFFSKISGVLTFMTSFYIPGSIMLCVY    141 - 210
YRIYLIAKEQARLISDANQKLQIGLEMKNGISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYI    211 - 280
IPPTLNDVLIWFGYLNSTFNPMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS               281 - 339
//

Text Mined References (23)

PMID Year Title