Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 55.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

AA Sequence

MVNNFSQAEAVELCYKNVNESCIKTPYSPGPRSILYAVLGFGAVLAAFGNLLVMIAILHFKQLHTPTNFL      1 - 70
IASLACADFLVGVTVMPFSTVRSVESCWYFGDSYCKFHTCFDTSFCFASLFHLCCISVDRYIAVTDPLTY     71 - 140
PTKFTVSVSGICIVLSWFFSVTYSFSIFYTGANEEGIEELVVALTCVGGCQAPLNQNWVLLCFLLFFIPN    141 - 210
VAMVFIYSKIFLVAKHQARKIESTASQAQSSSESYKERVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVI    211 - 280
DAYMNFITPPYVYEILVWCVYYNSAMNPLIYAFFYQWFGKAIKLIVSGKVLRTDSSTTNLFSEEVETD      281 - 348
//

Text Mined References (7)

PMID Year Title