Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00
PubTator Score 55.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
20006992 Observational study of gene-disease association. (HuGE Navigator)
16878137 Previous studies reported TAAR expression in brain. This paper found TAAR expression only in olfactory epithelial cells and that each TAAR detects a unique set of amine ligands. TAARs seem to function as a family of chemosensory receptors for amines.

AA Sequence

MVNNFSQAEAVELCYKNVNESCIKTPYSPGPRSILYAVLGFGAVLAAFGNLLVMIAILHFKQLHTPTNFL      1 - 70
IASLACADFLVGVTVMPFSTVRSVESCWYFGDSYCKFHTCFDTSFCFASLFHLCCISVDRYIAVTDPLTY     71 - 140
PTKFTVSVSGICIVLSWFFSVTYSFSIFYTGANEEGIEELVVALTCVGGCQAPLNQNWVLLCFLLFFIPN    141 - 210
VAMVFIYSKIFLVAKHQARKIESTASQAQSSSESYKERVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVI    211 - 280
DAYMNFITPPYVYEILVWCVYYNSAMNPLIYAFFYQWFGKAIKLIVSGKVLRTDSSTTNLFSEEVETD      281 - 348
//

Publication (7)

PMID Year Title
20006992 2010 Correlation of a set of gene variants, life events and personality features on adult ADHD severity.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
16878137 2006 A second class of chemosensory receptors in the olfactory epithelium.
15718104 2005 Trace amine-associated receptors form structurally and functionally distinct subfamilies of novel G protein-coupled receptors.
14559210 2003 Discovery of a null mutation in a human trace amine receptor gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11459929 2001 Trace amines: identification of a family of mammalian G protein-coupled receptors.