Property Summary

NCBI Gene PubMed Count 27
PubMed Score 115.07
PubTator Score 79.86

Knowledge Summary

Patent (4,065)

TINX Plot

  Disease (3)

Gene RIF (27)

AA Sequence

MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFL      1 - 70
VASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVY     71 - 140
PTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPT    141 - 210
FIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLI    211 - 280
DAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI         281 - 345
//

Text Mined References (27)

PMID Year Title