Property Summary

NCBI Gene PubMed Count 26
Grant Count 1
Funding $17,479
PubMed Score 111.40
PubTator Score 79.86

Knowledge Summary

Patent (4,065)

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q96RI8 Q5VUQ4 TaR-6
Symbols TA4
TAR4
TAR6
TRAR4
taR-4
taR-6

Gene

PANTHER Protein Class (2)

 Grant Application (1)

  TechDev Info (1)

Gene RIF (26)

PMID Text
20493543 The results of this study suggested a possible role of TAAR6 in antidepressant response and suicide behavior in patients with depressive disorder
20493543 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19766166 This study provides preliminary evidence that HSP-70 may play a role in the disrupted mechanisms that lead to BPD.
19766166 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19643584 Analysis of epistasis between a set of variations located in the TAAR6 and HSP-70 genes found weak associations with the risk of psychosis and response to antipsychotic treatment
19643584 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19582769 an epistastic effect between a set of TAAR6 and HSP-70 gene variations has a role in major mood disorders
19345712 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18973992 Here we demonstrate that TAAR6 is not associated with schizophrenia in the ICCSS sample.
More...

AA Sequence

MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFL      1 - 70
VASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVY     71 - 140
PTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPT    141 - 210
FIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLI    211 - 280
DAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI         281 - 345
//

Publication (26)

PMID Year Title
20493543 2010 TAAR6 variations possibly associated with antidepressant response and suicidal behavior.
19766166 2009 TAAR 6 and HSP-70 variations associated with bipolar disorder.
19643584 2009 Epistasis between a set of variations located in the TAAR6 and HSP-70 genes toward schizophrenia and response to antipsychotic treatment.
19582769 2010 Investigation of an epistastic effect between a set of TAAR6 and HSP-70 genes variations and major mood disorders.
19345712 2009 Influence of TAAR6 polymorphisms on response to aripiprazole.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18973992 2009 The trace amine associated receptor (TAAR6) gene is not associated with schizophrenia in the Irish Case-Control Study of Schizophrenia (ICCSS) sample.
18628684 2008 No support for an association with TAAR6 and schizophrenia in a linked population of European ancestry.
18583103 2008 TAAR6 variation effect on clinic presentation and outcome in a sample of schizophrenic in-patients: an open label study.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
More...