Property Summary

NCBI Gene PubMed Count 26
PubMed Score 111.40
PubTator Score 79.86

Knowledge Summary

Patent (4,065)

TINX Plot

  Disease Sources (2)

Disease Target Count
Schizophrenia 503
Disease Target Count Z-score Confidence
Squamous cell carcinoma 96 4.868 2.4
Cervical cancer 23 4.487 2.2

Synonym

Accession Q96RI8 Q5VUQ4 TaR-6
Symbols TA4
TAR4
TAR6
TRAR4
taR-4
taR-6

Gene

PANTHER Protein Class (2)

  Ortholog (4)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Opossum OMA EggNOG Inparanoid

  TechDev Info (1)

Gene RIF (26)

PMID Text
20493543 The results of this study suggested a possible role of TAAR6 in antidepressant response and suicide behavior in patients with depressive disorder
20493543 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19766166 This study provides preliminary evidence that HSP-70 may play a role in the disrupted mechanisms that lead to BPD.
19766166 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19643584 Analysis of epistasis between a set of variations located in the TAAR6 and HSP-70 genes found weak associations with the risk of psychosis and response to antipsychotic treatment
19643584 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19582769 an epistastic effect between a set of TAAR6 and HSP-70 gene variations has a role in major mood disorders
19345712 Observational study of gene-disease association. (HuGE Navigator)
18978678 Observational study of gene-disease association. (HuGE Navigator)
18973992 Here we demonstrate that TAAR6 is not associated with schizophrenia in the ICCSS sample.
More...

AA Sequence

MSSNSSLLVAVQLCYANVNGSCVKIPFSPGSRVILYIVFGFGAVLAVFGNLLVMISILHFKQLHSPTNFL      1 - 70
VASLACADFLVGVTVMPFSMVRTVESCWYFGRSFCTFHTCCDVAFCYSSLFHLCFISIDRYIAVTDPLVY     71 - 140
PTKFTVSVSGICISVSWILPLMYSGAVFYTGVYDDGLEELSDALNCIGGCQTVVNQNWVLTDFLSFFIPT    141 - 210
FIMIILYGNIFLVARRQAKKIENTGSKTESSSESYKARVARRERKAAKTLGVTVVAFMISWLPYSIDSLI    211 - 280
DAFMGFITPACIYEICCWCAYYNSAMNPLIYALFYPWFRKAIKVIVTGQVLKNSSATMNLFSEHI         281 - 345
//

Text Mined References (26)

PMID Year Title
20493543 2010 TAAR6 variations possibly associated with antidepressant response and suicidal behavior.
19766166 2009 TAAR 6 and HSP-70 variations associated with bipolar disorder.
19643584 2009 Epistasis between a set of variations located in the TAAR6 and HSP-70 genes toward schizophrenia and response to antipsychotic treatment.
19582769 2010 Investigation of an epistastic effect between a set of TAAR6 and HSP-70 genes variations and major mood disorders.
19345712 2009 Influence of TAAR6 polymorphisms on response to aripiprazole.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18973992 2009 The trace amine associated receptor (TAAR6) gene is not associated with schizophrenia in the Irish Case-Control Study of Schizophrenia (ICCSS) sample.
18628684 2008 No support for an association with TAAR6 and schizophrenia in a linked population of European ancestry.
18583103 2008 TAAR6 variation effect on clinic presentation and outcome in a sample of schizophrenic in-patients: an open label study.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
More...