Property Summary

Ligand Count 151
NCBI Gene PubMed Count 218
PubMed Score 350.32
PubTator Score 566.77

Knowledge Summary

Patent (58,079)

TINX Plot

  Disease (8)

Expression

Synonym

Accession Q96RI1 A1L4K5 B7Z412 B7ZM06 F8VYG8 Q8NFP5 Q8NFP6 Q92943
Symbols BAR
FXR
HRR1
HRR-1
PFIC5
RIP14

Gene

PDB

1OSH   1OSK   3BEJ   3DCT   3DCU   3FLI   3FXV   3GD2   3HC5   3HC6   3L1B   3OKH   3OKI   3OLF   3OMK   3OMM   3OOF   3OOK   3P88   3P89   3RUT   3RUU   3RVF   4OIV   4QE6   4QE8   4WVD   5IAW   5ICK   5Q0I   5Q0J   5Q0K   5Q0L   5Q0M   5Q0N   5Q0O   5Q0P   5Q0Q   5Q0R   5Q0S   5Q0T   5Q0U   5Q0V   5Q0W   5Q0X   5Q0Y   5Q0Z   5Q10   5Q11   5Q12   5Q13   5Q14   5Q15   5Q16   5Q17   5Q18   5Q19   5Q1A   5Q1B   5Q1C   5Q1D   5Q1E   5Q1F   5Q1G   5Q1H   5Q1I  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (181)

AA Sequence

MVMQFQGLENPIQISPHCSCTPSGFFMEMMSMKPAKGVLTEQVAGPLGQNLEVEPYSQYSNVQFPQVQPQ      1 - 70
ISSSSYYSNLGFYPQQPEEWYSPGIYELRRMPAETLYQGETEVAEMPVTKKPRMGASAGRIKGDELCVVC     71 - 140
GDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCKEMGMLAECMYTG    141 - 210
LLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKTELTPDQQTLLHFIMDSYNKQRMP    211 - 280
QEITNKILKEEFSAEENFLILTEMATNHVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIF    281 - 350
NKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK    351 - 420
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ        421 - 486
//

Text Mined References (236)

PMID Year Title