Property Summary

NCBI Gene PubMed Count 79
Grant Count 2
R01 Count 1
Funding $150,148.53
PubMed Score 30.53
PubTator Score 103.13

Knowledge Summary

Patent (31,178)

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.400 0.000

Synonym

Accession Q96RI0 O76067 Q6DK42 PAR-4
Symbols PAR4

Gene

PANTHER Protein Class (2)

 Grant Application (2)

PDB

2ZPK   3QDZ  

  TechDev Info (1)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
652250 confirmatory 14 / 0 / 177 Discovery of Novel Antagonists of Protease activated receptor 4: Single Point
652253 confirmatory 2 / 0 / 8 Discovery of Novel Antagonists of Protease activated receptor 4: CRC Assay
652261 summary 0 / 0 / 0 ML354 Discovery of Novel Antagonists of Protease activated receptor 4

Gene RIF (62)

PMID Text
27126938 Suppression of PAR4 expression has no significant effect on the proliferation of SW620 cells, but can inhibit the migration of the cells.
26569550 Both GPIbalpha and PAR4 are required for thrombin-induced reactive oxygen species formation in human platelets.
26020638 Bladder PAR activation elicits urothelial MIF release and urothelial MIF receptor signaling at least partly through CXCR4 to result in abdominal hypersensitivity without overt bladder inflammation
25876034 protease-activated receptor 4 and Trefoil factor 2 are expressed in human colorectal cancer
25821117 Findings suggested that F2RL3 methylation is a very strong predictor of lung cancer risk and mortality, particularly at older age.
25664811 The PAR4 expression and activation via intracellular signaling pathways and the role of PAR4 signaling pathways in the development and maintenance of pain.
25293779 Quantitative trait locus analysis identified 3 common single nucleotide polymorphisms in the PAR4 gene (F2RL3) associated with PAR4-induced platelet aggregation. Thr120 was more common in blacks than whites.
25278289 Washed platelets from black volunteers were hyperaggregable in response to PAR4-mediated platelet stimulation compared with whites.
25239438 PAR-4 appears to play a hitherto unsuspected role in diabetic vasculopathy.
25120239 This review summarizes the roles of PAR4 in coagulation and other extracellular protease pathways.
More...

AA Sequence

MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDTLELPDSSRAL      1 - 70
LLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAAADLLLALALPPRIAYHLRGQ     71 - 140
RWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVHPLRARALRGRRLALGLCMAAWLMAAALALP    141 - 210
LTLQRQTFRLARSDRVLCHDALPLDAQASHWQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGH    211 - 280
ALRLTAVVLASAVAFFVPSNLLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDK    281 - 350
VRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ                                       351 - 385
//

Text Mined References (79)

PMID Year Title
27402844 2016 Protease-activated Receptor-4 Signaling and Trafficking Is Regulated by the Clathrin Adaptor Protein Complex-2 Independent of ?-Arrestins.
27126938 2016 [Downregulation of proteinase activated receptor 4 inhibits migration of SW620 human colorectal cancer cells].
26569550 2015 Thrombin-induced reactive oxygen species generation in platelets: A novel role for protease-activated receptor 4 and GPIb?.
26020638 2015 Macrophage Migration Inhibitory Factor Mediates PAR-Induced Bladder Pain.
25876034 2015 Increased expression of protease-activated receptor 4 and Trefoil factor 2 in human colorectal cancer.
25821117 2015 F2RL3 methylation, lung cancer incidence and mortality.
25664811 2015 New insights into protease-activated receptor 4 signaling pathways in the pathogenesis of inflammation and neuropathic pain: a literature review.
25293779 2014 Common variants in the human platelet PAR4 thrombin receptor alter platelet function and differ by race.
25278289 2014 Mechanism of race-dependent platelet activation through the protease-activated receptor-4 and Gq signaling axis.
25239438 2014 Thrombin receptor protease-activated receptor 4 is a key regulator of exaggerated intimal thickening in diabetes mellitus.
More...