Property Summary

Ligand Count 1
NCBI Gene PubMed Count 84
PubMed Score 34.12
PubTator Score 103.13

Knowledge Summary

Patent (31,178)


  Disease (2)

Disease Target Count P-value
lung adenocarcinoma 2716 1.2e-20


  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.400 1.2e-20

 CSPA Cell Line (1)

Gene RIF (68)

AA Sequence

VRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ                                       351 - 385

Text Mined References (84)

PMID Year Title