Property Summary

NCBI Gene PubMed Count 26
Grant Count 24
R01 Count 17
Funding $2,365,418
PubMed Score 11.16
PubTator Score 32.64

Knowledge Summary

Patent (7,886)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -2.700 0.000
posterior fossa group B ependymoma 2.000 0.000
group 3 medulloblastoma 1.800 0.000
primitive neuroectodermal tumor 1.100 0.010
tuberculosis -1.900 0.001
interstitial cystitis 1.500 0.006
sarcoidosis -1.200 0.000
ductal carcinoma in situ 1.100 0.009
invasive ductal carcinoma 1.200 0.005

Gene RIF (9)

PMID Text
23853095 PASK phosphorylates and inactivates GSK3beta, thereby preventing PDX-1 serine phosphorylation and alleviating GSK3beta-mediated PDX-1 protein degradation in pancreatic beta-cells.
23721480 Mutations that affect PAS domain cause a severe protein trafficking defect and change the interactions with Kv11.1 channels.
22219681 The role of PAS kinase in PASsing the glucose signal.
22065581 Per-Arnt-Sim (PAS) domain-containing protein kinase (PASK) has a role in insulin hypersecretion
21181396 PASK is involved in the regulation of glucagon secretion by glucose and may be a useful target for the treatment of type 2 diabetes.
20943661 Structural bases of PAS domain-regulated kinase (PASK) activation in the absence of activation loop phosphorylation.
17595531 identified the multifunctional eukaryotic translation elongation factor eEF1A1 as a novel interaction partner of PASKIN in the nuclei of testis germ cells and in the midpiece of sperm tails
15148392 Results suggest that elevated glucose concentrations rapidly increase Per-Arnt-Sim kinase activity in pancreatic islet beta cells, followed by up-regulation by glucose of preproinsulin and pancreatic duodenum homeobox 1 gene expression.
11688972 molecular cloning, gene expression, and comparison with mouse protein

AA Sequence

MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQSRTALSEDRWS      1 - 70
SYCLSSLAAQNICTSKLHCPAAPEHTDPSEPRGSVSCCSLLRGLSSGWSSPLLPAPVCNPNKAIFTVDAK     71 - 140
TTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDIISRSGEK    141 - 210
IPVSVWMKRMRQERRLCCVVVLEPVERVSTWVAFQSDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPS    211 - 280
VQLPPSGQHIPKNLKIQRSVGRARDGTTFPLSLKLKSQPSSEEATTGEAAPVSGYRASVWVFCTISGLIT    281 - 350
LLPDGTIHGINHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYNSSLQLPDLASCLDVGNESGCGER    351 - 420
TLDPWQGQDPAEGGQDPRINVVLAGGHVVPRDEIRKLMESQDIFTGTQTELIAGGQLLSCLSPQPAPGVD    421 - 490
NVPEGSLPVHGEQALPKDQQITALGREEPVAIESPGQDLLGESRSEPVDVKPFASCEDSEAPVPAEDGGS    491 - 560
DAGMCGLCQKAQLERMGVSGPSGSDLWAGAAVAKPQAKGQLAGGSLLMHCPCYGSEWGLWWRSQDLAPSP    561 - 630
SGMAGLSFGTPTLDEPWLGVENDREELQTCLIKEQLSQLSLAGALDVPHAELVPTECQAVTAPVSSCDLG    631 - 700
GRDLCGGCTGSSSACYALATDLPGGLEAVEAQEVDVNSFSWNLKELFFSDQTDQTSSNCSCATSELRETP    701 - 770
SSLAVGSDPDVGSLQEQGSCVLDDRELLLLTGTCVDLGQGRRFRESCVGHDPTEPLEVCLVSSEHYAASD    771 - 840
RESPGHVPSTLDAGPEDTCPSAEEPRLNVQVTSTPVIVMRGAAGLQREIQEGAYSGSCYHRDGLRLSIQF    841 - 910
EVRRVELQGPTPLFCCWLVKDLLHSQRDSAARTRLFLASLPGSTHSTAAELTGPSLVEVLRARPWFEEPP    911 - 980
KAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVT    981 - 1050
LEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLR   1051 - 1120
LKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLG   1121 - 1190
VTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADY   1191 - 1260
TWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRLLTS          1261 - 1323
//

Text Mined References (35)

PMID Year Title
23853095 2013 Per-Arnt-Sim kinase regulates pancreatic duodenal homeobox-1 protein stability via phosphorylation of glycogen synthase kinase 3? in pancreatic ?-cells.
23721480 2013 Trafficking defects in PAS domain mutant Kv11.1 channels: roles of reduced domain stability and altered domain-domain interactions.
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22219681 2010 The role of PAS kinase in PASsing the glucose signal.
22065581 2011 Human mutation within Per-Arnt-Sim (PAS) domain-containing protein kinase (PASK) causes basal insulin hypersecretion.
21418524 2011 Substrate preference and phosphatidylinositol monophosphate inhibition of the catalytic domain of the Per-Arnt-Sim domain kinase PASKIN.
21327866 2011 Per-arnt-sim (PAS) domain kinase (PASK) as a regulator of glucagon secretion.
21181396 2011 Per-arnt-sim (PAS) domain-containing protein kinase is downregulated in human islets in type 2 diabetes and regulates glucagon secretion.
More...