Property Summary

NCBI Gene PubMed Count 26
PubMed Score 11.16
PubTator Score 32.64

Knowledge Summary

Patent (7,886)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 8.14603830906532E-11
osteosarcoma 7933 2.30033121029991E-8
malignant mesothelioma 3163 2.19276707086527E-6
sarcoidosis 368 4.04939570743856E-5
group 3 medulloblastoma 2254 4.12275153569568E-5
tuberculosis 1563 9.76884957755812E-4
invasive ductal carcinoma 2950 0.00472303926653523
interstitial cystitis 2299 0.00649530082050042
ductal carcinoma in situ 1745 0.00853123139821749
primitive neuroectodermal tumor 3031 0.00952200476176915
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.300 0.000
osteosarcoma -2.700 0.000
posterior fossa group B ependymoma 2.000 0.000
group 3 medulloblastoma 1.800 0.000
primitive neuroectodermal tumor 1.100 0.010
tuberculosis -1.900 0.001
interstitial cystitis 1.500 0.006
sarcoidosis -1.200 0.000
ductal carcinoma in situ 1.100 0.009
invasive ductal carcinoma 1.200 0.005

Synonym

Accession Q96RG2 G5E9F1 Q05BE4 Q68DY3 Q6GSJ5 Q86XH6 Q99763 Q9UFR7 PAS-kinase
Symbols STK37
PASKIN

Gene

PDB

1LL8   3DLS  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA Inparanoid

 GWAS Trait (1)

Pathway (1)

Gene RIF (9)

PMID Text
23853095 PASK phosphorylates and inactivates GSK3beta, thereby preventing PDX-1 serine phosphorylation and alleviating GSK3beta-mediated PDX-1 protein degradation in pancreatic beta-cells.
23721480 Mutations that affect PAS domain cause a severe protein trafficking defect and change the interactions with Kv11.1 channels.
22219681 The role of PAS kinase in PASsing the glucose signal.
22065581 Per-Arnt-Sim (PAS) domain-containing protein kinase (PASK) has a role in insulin hypersecretion
21181396 PASK is involved in the regulation of glucagon secretion by glucose and may be a useful target for the treatment of type 2 diabetes.
20943661 Structural bases of PAS domain-regulated kinase (PASK) activation in the absence of activation loop phosphorylation.
17595531 identified the multifunctional eukaryotic translation elongation factor eEF1A1 as a novel interaction partner of PASKIN in the nuclei of testis germ cells and in the midpiece of sperm tails
15148392 Results suggest that elevated glucose concentrations rapidly increase Per-Arnt-Sim kinase activity in pancreatic islet beta cells, followed by up-regulation by glucose of preproinsulin and pancreatic duodenum homeobox 1 gene expression.
11688972 molecular cloning, gene expression, and comparison with mouse protein

AA Sequence

MEDGGLTAFEEDQRCLSQSLPLPVSAEGPAAQTTAEPSRSFSSAHRHLSRRNGLSRLCQSRTALSEDRWS      1 - 70
SYCLSSLAAQNICTSKLHCPAAPEHTDPSEPRGSVSCCSLLRGLSSGWSSPLLPAPVCNPNKAIFTVDAK     71 - 140
TTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDIISRSGEK    141 - 210
IPVSVWMKRMRQERRLCCVVVLEPVERVSTWVAFQSDGTVTSCDSLFAHLHGYVSGEDVAGQHITDLIPS    211 - 280
VQLPPSGQHIPKNLKIQRSVGRARDGTTFPLSLKLKSQPSSEEATTGEAAPVSGYRASVWVFCTISGLIT    281 - 350
LLPDGTIHGINHSFALTLFGYGKTELLGKNITFLIPGFYSYMDLAYNSSLQLPDLASCLDVGNESGCGER    351 - 420
TLDPWQGQDPAEGGQDPRINVVLAGGHVVPRDEIRKLMESQDIFTGTQTELIAGGQLLSCLSPQPAPGVD    421 - 490
NVPEGSLPVHGEQALPKDQQITALGREEPVAIESPGQDLLGESRSEPVDVKPFASCEDSEAPVPAEDGGS    491 - 560
DAGMCGLCQKAQLERMGVSGPSGSDLWAGAAVAKPQAKGQLAGGSLLMHCPCYGSEWGLWWRSQDLAPSP    561 - 630
SGMAGLSFGTPTLDEPWLGVENDREELQTCLIKEQLSQLSLAGALDVPHAELVPTECQAVTAPVSSCDLG    631 - 700
GRDLCGGCTGSSSACYALATDLPGGLEAVEAQEVDVNSFSWNLKELFFSDQTDQTSSNCSCATSELRETP    701 - 770
SSLAVGSDPDVGSLQEQGSCVLDDRELLLLTGTCVDLGQGRRFRESCVGHDPTEPLEVCLVSSEHYAASD    771 - 840
RESPGHVPSTLDAGPEDTCPSAEEPRLNVQVTSTPVIVMRGAAGLQREIQEGAYSGSCYHRDGLRLSIQF    841 - 910
EVRRVELQGPTPLFCCWLVKDLLHSQRDSAARTRLFLASLPGSTHSTAAELTGPSLVEVLRARPWFEEPP    911 - 980
KAVELEGLAACEGEYSQKYSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVT    981 - 1050
LEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLR   1051 - 1120
LKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLG   1121 - 1190
VTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADY   1191 - 1260
TWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRLLTS          1261 - 1323
//

Text Mined References (35)

PMID Year Title
23853095 2013 Per-Arnt-Sim kinase regulates pancreatic duodenal homeobox-1 protein stability via phosphorylation of glycogen synthase kinase 3? in pancreatic ?-cells.
23721480 2013 Trafficking defects in PAS domain mutant Kv11.1 channels: roles of reduced domain stability and altered domain-domain interactions.
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22219681 2010 The role of PAS kinase in PASsing the glucose signal.
22065581 2011 Human mutation within Per-Arnt-Sim (PAS) domain-containing protein kinase (PASK) causes basal insulin hypersecretion.
21418524 2011 Substrate preference and phosphatidylinositol monophosphate inhibition of the catalytic domain of the Per-Arnt-Sim domain kinase PASKIN.
21327866 2011 Per-arnt-sim (PAS) domain kinase (PASK) as a regulator of glucagon secretion.
21181396 2011 Per-arnt-sim (PAS) domain-containing protein kinase is downregulated in human islets in type 2 diabetes and regulates glucagon secretion.
More...