Property Summary

NCBI Gene PubMed Count 22
Grant Count 7
R01 Count 7
Funding $443,923.85
PubMed Score 6.46
PubTator Score 9.63

Knowledge Summary

Patent

No data available

Expression

Gene RIF (6)

PMID Text
25915798 Viral bimolecular fluorescence complementation assay demonstrates the association of HIV-1 Nef with SNX18 in cells
23878278 SNX18 promotes autophagosome formation by virtue of its ability to remodel membranes and provide membrane to forming autophagosomes.
22718350 The sorting nexin 9 (SNX9) subfamily members - SNX9, SNX18 and SNX33 - are required for progression and completion of mitosis.
21969467 FIP5-SNX18 complex plays a pivotal role in the polarized transport of apical proteins during apical lumen initiation in epithelial cells.
20427313 functions in multiple pathways of endocytosis at the plasma membrane
18411244 The results indicate that SNX9-family members make up discrete membrane-scission units together with dynamin, and suggest that SNX18 mediates budding of carriers for AP-1-positive endosomal trafficking.

AA Sequence

MALRARALYDFRSENPGEISLREHEVLSLCSEQDIEGWLEGVNSRGDRGLFPASYVQVIRAPEPGPAGDG      1 - 70
GPGAPARYANVPPGGFEPLPVAPPASFKPPPDAFQALLQPQQAPPPSTFQPPGAGFPYGGGALQPSPQQL     71 - 140
YGGYQASQGSDDDWDDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSV    141 - 210
PPQHHPSGPKSSATVSRNLNRFSTFVKSGGEAFVLGEASGFVKDGDKLCVVLGPYGPEWQENPYPFQCTI    211 - 280
DDPTKQTKFKGMKSYISYKLVPTHTQVPVHRRYKHFDWLYARLAEKFPVISVPHLPEKQATGRFEEDFIS    281 - 350
KRRKGLIWWMNHMASHPVLAQCDVFQHFLTCPSSTDEKAWKQGKRKAEKDEMVGANFFLTLSTPPAAALD    351 - 420
LQEVESKIDGFKCFTKKMDDSALQLNHTANEFARKQVTGFKKEYQKVGQSFRGLSQAFELDQQAFSVGLN    421 - 490
QAIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQGHLANFPDIIHVQKGKAWPLEQVIWSVLCRLKGA    491 - 560
TLTAVPLWVSESYSTGEEASRDVDAWVFSLECKLDCSTGSFLLEYLALGNEYSFSKVQRVPLMTVLSF      561 - 628
//

Publication (27)

PMID Year Title
24591568 2014 FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23878278 2013 Membrane remodeling by the PX-BAR protein SNX18 promotes autophagosome formation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22718350 2012 SNX9, SNX18 and SNX33 are required for progression through and completion of mitosis.
22542470 2012 Genome-wide association study of antibody response to smallpox vaccine.
21969467 2011 Interaction between FIP5 and SNX18 regulates epithelial lumen formation.
21048941 2010 The SNX-PX-BAR family in macropinocytosis: the regulation of macropinosome formation by SNX-PX-BAR proteins.
20491914 2010 The E3 ubiquitin ligase Itch regulates sorting nexin 9 through an unconventional substrate recognition domain.
More...