Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.48
PubTator Score 9.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
oligodendroglioma 1.300 0.000
astrocytoma 1.100 0.000
glioblastoma 1.700 0.000
osteosarcoma 1.881 0.004
group 3 medulloblastoma 3.400 0.000
cystic fibrosis -1.454 0.000
atypical teratoid / rhabdoid tumor 1.300 0.021
medulloblastoma, large-cell 1.800 0.000
primitive neuroectodermal tumor 2.800 0.000
adrenocortical carcinoma 1.236 0.002
pediatric high grade glioma 1.300 0.000
pilocytic astrocytoma 1.300 0.000
Breast cancer -1.100 0.001
acute myeloid leukemia -1.400 0.011

Gene RIF (7)

PMID Text
24393131 Our findings further support ZNF300P1 as frequently methylated in ovarian cancer and reveal a novel function for ZNF300P1 lincRNA expression
21777376 A novel function for ZNF300 in tumour development was identified that may uniquely link inflammation and NF-kappa B to tumourigenesis in humans but not in mice.
20585888 Data show that co-expression of ZNF300 and Egr1 lead to enhanced IL-2Rbeta promoter activity, and suggest that ZNF300 is another regulator of the human IL-2Rbeta promoter.
20549515 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20471086 ZNF300 was activated by PU.1 and suggested that the regulation may be involved in the progression of leukemia development and hematopoietic differentiation.
18350257 Results show that the ZNF300 gene encodes a 68-kDa nuclear protein that binds DNA in a sequence-specific manner.
17541838 ZNF-300 and novel splice variant ZNF300-B are both expressed highly in human testis.

AA Sequence

MMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHLVSMGYPVSKPDVISKLEQGEEPWIIK      1 - 70
GDISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSLCSILKVCQGDGQLQRFLEN     71 - 140
QDKLFRQVTFVNSKTVTEASGHKYNPLGKIFQECIETDISIQRFHKYDAFKKNLKPNIDLPSCYKSNSRK    141 - 210
KPDQSFGGGKSSSQSEPNSNLEKIHNGVIPFDDNQCGNVFRNTQSLIQYQNVETKEKSCVCVTCGKAFAK    211 - 280
KSQLIVHQRIHTGKKPYDCGACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQRVHTGE    281 - 350
KPYECSECGKAFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHTGEKPYECTECGKAFCE    351 - 420
KSHLIIHKRIHTGEKPYKCAQCEEAFSRKTELITHQLVHTGEKPYECTECGKTFSRKSQLIIHQRTHTGE    421 - 490
KPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQRIHTGEKPYICAECGKAFSQ    491 - 560
KSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHTVVKS                              561 - 604
//

Publication (18)

PMID Year Title
24393131 2014 ZNF300P1 encodes a lincRNA that regulates cell polarity and is epigenetically silenced in type II epithelial ovarian cancer.
23665872 2013 Novel activity of KRAB domain that functions to reinforce nuclear localization of KRAB-containing zinc finger proteins by interacting with KAP1.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21777376 2012 Overexpression of the human ZNF300 gene enhances growth and metastasis of cancer cells through activating NF-kB pathway.
20585888 2010 ZNF300, a recently identified human transcription factor, activates the human IL-2R? promoter through the overlapping ZNF300/EGR1 binding site.
20549515 2010 Genome-wide searching of rare genetic variants in WTCCC data.
20471086 2010 PU.1 can regulate the ZNF300 promoter in APL-derived promyelocytes HL-60.
18350257 2008 Identification of the DNA binding element of the human ZNF300 protein.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
More...