Property Summary

NCBI Gene PubMed Count 33
PubMed Score 16.77
PubTator Score 159.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 1.41095842456917E-12
breast carcinoma 1614 6.3776954998372E-5
medulloblastoma, large-cell 6234 1.33924852624263E-4
glioblastoma 5572 1.42389963293037E-4
non-inflammatory breast cancer 208 1.57569480245326E-4
adult high grade glioma 2148 4.54005282420954E-4
group 3 medulloblastoma 2254 0.00892131212026794
non primary Sjogren syndrome sicca 840 0.0139887091785205
Disease Target Count Z-score Confidence
Hyperargininemia 7 4.006 2.0
Citrullinemia 13 3.683 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -1.100 0.000
medulloblastoma, large-cell -1.200 0.000
breast carcinoma 1.600 0.000
adult high grade glioma -1.200 0.000
group 3 medulloblastoma -1.100 0.009
non primary Sjogren syndrome sicca 1.300 0.014
lung adenocarcinoma 1.300 0.000
non-inflammatory breast cancer 1.100 0.000

Synonym

Accession Q96RE7 NAC-1
Symbols NAC1
BEND8
NAC-1
BTBD30
BTBD14B

Gene

PDB

3GA1   4U2N  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (24)

PMID Text
26172271 NAC1 has potential as a marker for distinguishing OED from CIS/OSCC
25891951 NACC1 can be modified by SUMO paralogues, and cooperates with promyelocytic leukemia protein.
25484205 strategy for the purification of tethered POZ domains that form forced heterodimers is described, and crystal structures of the heterodimeric POZ domains of Miz1/BCL6 and of Miz1/NAC1 are reported
24200849 NAC1 is essential and sufficient for activation of FOXQ1
23252869 low expression of NAC1 predicts poor prognosis for patients with pancreatic ductal adenocarcinoma.
22993327 Uterine sarcomas with NAC1 overexpression are clinically the most aggressive, chemoresistant, and radioresistant tumors.
22665369 The identification of an NAC1 NLS thus clarifies the mechanism through which NAC1 translocates to the nucleus to regulate the transcription of genes involved in oncogenicity and pluripotency.
22665267 Results not only reveal a previously unrecognized function of NAC1, the molecular pathway involved and its impact on pathogenesis of tumor initiation and development, but also identify a novel senescence regulator
22653145 NAC1 expression was significantly correlated with FASN expression in both OCCC samples and OCCC cell lines.
21889186 NAC1 overexpression is critical to the growth and survival of cervical carcinomas irrespective of histologic type.
More...

AA Sequence

MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNNSRSAVVELP      1 - 70
AAVQPQSFQQILSFCYTGRLSMNVGDQFLLMYTAGFLQIQEIMEKGTEFFLKVSSPSCDSQGLHAEEAPS     71 - 140
SEPQSPVAQTSGWPACSTPLPLVSRVKTEQQESDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPD    141 - 210
LAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHN    211 - 280
EEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQ    281 - 350
IGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGI    351 - 420
RSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYT    421 - 490
TFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ                                     491 - 527
//

Text Mined References (42)

PMID Year Title
26172271 2015 Nucleus Accumbens-Associated Protein 1 Expression Has Potential as a Marker for Distinguishing Oral Epithelial Dysplasia and Squamous Cell Carcinoma.
25891951 2015 Nucleus accumbens associated 1 is recruited within the promyelocytic leukemia nuclear body through SUMO modification.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25484205 2014 Structures of heterodimeric POZ domains of Miz1/BCL6 and Miz1/NAC1.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24200849 2014 Identification of the NAC1-regulated genes in ovarian cancer.
23252869 2012 Low expression of nucleus accumbens-associated protein 1 predicts poor prognosis for patients with pancreatic ductal adenocarcinoma.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...