Property Summary

NCBI Gene PubMed Count 36
PubMed Score 18.49
PubTator Score 159.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 4.5e-04
breast carcinoma 1.600 6.4e-05
glioblastoma -1.100 1.4e-04
group 3 medulloblastoma -1.100 8.9e-03
lung adenocarcinoma 1.300 1.4e-12
medulloblastoma, large-cell -1.200 1.3e-04
non primary Sjogren syndrome sicca 1.100 1.2e-02
non-inflammatory breast cancer 1.100 1.6e-04

Gene RIF (27)

AA Sequence

MAQTLQMEIPNFGNSILECLNEQRLQGLYCDVSVVVKGHAFKAHRAVLAASSSYFRDLFNNSRSAVVELP      1 - 70
AAVQPQSFQQILSFCYTGRLSMNVGDQFLLMYTAGFLQIQEIMEKGTEFFLKVSSPSCDSQGLHAEEAPS     71 - 140
SEPQSPVAQTSGWPACSTPLPLVSRVKTEQQESDSVQCMPVAKRLWDSGQKEAGGGGNGSRKMAKFSTPD    141 - 210
LAANRPHQPPPPQQAPVVAAAQPAVAAGAGQPAGGVAAAGGVVSGPSTSERTSPGTSSAYTSDSPGSYHN    211 - 280
EEDEEEDGGEEGMDEQYRQICNMYTMYSMMNVGQTAEKVEALPEQVAPESRNRIRVRQDLASLPAELINQ    281 - 350
IGNRCHPKLYDEGDPSEKLELVTGTNVYITRAQLMNCHVSAGTRHKVLLRRLLASFFDRNTLANSCGTGI    351 - 420
RSSTNDPRRKPLDSRVLHAVKYYCQNFAPNFKESEMNAIAADMCTNARRVVRKSWMPKVKVLKAEDDAYT    421 - 490
TFISETGKIEPDMMGVEHGFETASHEGEAGPSAEALQ                                     491 - 527
//

Text Mined References (46)

PMID Year Title