Property Summary

NCBI Gene PubMed Count 25
Grant Count 3
R01 Count 1
Funding $117,652
PubMed Score 17.27
PubTator Score 21.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
25993340 Data suggest that expression of FCRL5 (but not FCRL4) on surface of atypical (perhaps dysfunctional) memory B-Lymphocytes is up-regulated by exposure to Plasmodium falciparum antigens in subjects in Uganda where malaria is endemic.
23616577 FCRL5 is a new type of receptor that recognizes intact IgG, possibly enabling B cells to sense Ig quality. Recognition of undamaged IgG molecules by FCRL5 could allow B cells to engage recently produced Abs.
22491254 FcRL5 binds all immunoglobulin (Ig)G isotypes with varied efficiency.
22028333 Enhanced proliferation and downstream isotype expression upon FCRL5 stimulation could reflect a physiological role for FCRL5 in the expansion and development of antigen-primed B cells.
20626413 Three of the FCRL5 tag SNPs, rs6667109, rs3811035 and rs6692977 showed association with Graves' disease. association with FCRL5 was secondary to linkage disequilibrium with the FCRL3, rs11264798 and rs10489678 SNPs.
20626413 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19775371 Single-nucleotide polymorphism in the FCRL5 gene and HLA-B27 is associated with ankylosing spondylitis.
19775371 Observational study of gene-disease association. (HuGE Navigator)
18802695 Down-regulation of FCRL5 is associated with acute lymphoblastic leukemia.
More...

AA Sequence

MLLWVILLVLAPVSGQFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRET      1 - 70
PDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDN     71 - 140
VLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFTRPVLRASSFQPISGNPVTLT    141 - 210
CETQLSLERSDVPLRFRFFRDDQTLGLGWSLSPNFQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQV    211 - 280
QIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENS    281 - 350
GNYYCTADNGLGAKPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVTLHCEAQRGSLPILYQFHHEGAA    351 - 420
LERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTVPVSHPVLTLSSAEALTFEGATV    421 - 490
TLHCEVQRGSPQILYQFYHEDMPLWSSSTPSVGRVSFSFSLTEGHSGNYYCTADNGFGPQRSEVVSLFVT    491 - 560
VPVSRPILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWFYHEDVTLGSSSAPSGGEASFNLSLTAEHSG    561 - 630
NYSCEANNGLVAQHSDTISLSVIVPVSRPILTFRAPRAQAVVGDLLELHCEALRGSSPILYWFYHEDVTL    631 - 700
GKISAPSGGGASFNLSLTTEHSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLTLRAPGTHAAVGDLLE    701 - 770
LHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGL    771 - 840
TANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQP    841 - 910
VYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPIIYSEVKVASTPVSGSLFLASSAPHR       911 - 977
//

Publication (28)

PMID Year Title
25993340 2015 FCRL5 Delineates Functionally Impaired Memory B Cells Associated with Plasmodium falciparum Exposure.
23616577 2013 Human Fc receptor-like 5 binds intact IgG via mechanisms distinct from those of Fc receptors.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
22491254 2012 Cutting edge: human FcRL4 and FcRL5 are receptors for IgA and IgG.
22044751 2011 Heritability and genome-wide association analysis of renal sinus fat accumulation in the Framingham Heart Study.
22028333 2012 Fc receptor-like 5 promotes B cell proliferation and drives the development of cells displaying switched isotypes.
20626413 2010 Association of Fc receptor-like 5 (FCRL5) with Graves' disease is secondary to the effect of FCRL3.
20590663 2010 Expression phenotype changes of EBV-transformed lymphoblastoid cell lines during long-term subculture and its clinical significance.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19775371 2009 A single-nucleotide polymorphism marker within the FCRL5 gene and HLA-B27 positive Han Chinese ankylosing spondylitis patients.
More...