Property Summary

NCBI Gene PubMed Count 29
PubMed Score 20.99
PubTator Score 21.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
chronic lymphosyte leukemia 1.200 1.3e-03
chronic rhinosinusitis 1.328 4.8e-02
cystic fibrosis and chronic rhinosinusit... 2.085 2.2e-03
interstitial cystitis 3.400 1.6e-04
intraductal papillary-mucinous adenoma (... 1.600 4.5e-02
lung adenocarcinoma 1.700 1.2e-11
medulloblastoma, large-cell 1.200 2.5e-04
non-small cell lung carcinoma 1.200 5.4e-16
osteosarcoma -5.255 5.7e-14
ovarian cancer -1.400 4.2e-05
pancreatic cancer 1.300 4.4e-02
pancreatic carcinoma 1.300 4.4e-02
periodontitis 2.200 9.9e-28
primary Sjogren syndrome 1.200 1.4e-03
tuberculosis 1.600 1.8e-07
ulcerative colitis 2.600 2.6e-05

Gene RIF (18)

AA Sequence

MLLWVILLVLAPVSGQFARTPRPIIFLQPPWTTVFQGERVTLTCKGFRFYSPQKTKWYHRYLGKEILRET      1 - 70
PDNILEVQESGEYRCQAQGSPLSSPVHLDFSSASLILQAPLSVFEGDSVVLRCRAKAEVTLNNTIYKNDN     71 - 140
VLAFLNKRTDFHIPHACLKDNGAYRCTGYKESCCPVSSNTVKIQVQEPFTRPVLRASSFQPISGNPVTLT    141 - 210
CETQLSLERSDVPLRFRFFRDDQTLGLGWSLSPNFQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQV    211 - 280
QIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENS    281 - 350
GNYYCTADNGLGAKPSKAVSLSVTVPVSHPVLNLSSPEDLIFEGAKVTLHCEAQRGSLPILYQFHHEGAA    351 - 420
LERRSANSAGGVAISFSLTAEHSGNYYCTADNGFGPQRSKAVSLSVTVPVSHPVLTLSSAEALTFEGATV    421 - 490
TLHCEVQRGSPQILYQFYHEDMPLWSSSTPSVGRVSFSFSLTEGHSGNYYCTADNGFGPQRSEVVSLFVT    491 - 560
VPVSRPILTLRVPRAQAVVGDLLELHCEAPRGSPPILYWFYHEDVTLGSSSAPSGGEASFNLSLTAEHSG    561 - 630
NYSCEANNGLVAQHSDTISLSVIVPVSRPILTFRAPRAQAVVGDLLELHCEALRGSSPILYWFYHEDVTL    631 - 700
GKISAPSGGGASFNLSLTTEHSGIYSCEADNGLEAQRSEMVTLKVAVPVSRPVLTLRAPGTHAAVGDLLE    701 - 770
LHCEALRGSPLILYRFFHEDVTLGNRSSPSGGASLNLSLTAEHSGNYSCEADNGLGAQRSETVTLYITGL    771 - 840
TANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQP    841 - 910
VYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPIIYSEVKVASTPVSGSLFLASSAPHR       911 - 977
//

Text Mined References (31)

PMID Year Title