Property Summary

NCBI Gene PubMed Count 63
Grant Count 94
R01 Count 54
Funding $13,494,048.37
PubMed Score 367.63
PubTator Score 200.32

Knowledge Summary

Patent (5,254)

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.200 0.000
cutaneous lupus erythematosus 1.200 0.006
juvenile dermatomyositis 1.530 0.000
lung cancer 1.400 0.000
diabetes mellitus -1.500 0.001
group 3 medulloblastoma 1.200 0.009
aldosterone-producing adenoma -1.022 0.009
invasive ductal carcinoma 1.400 0.002
ulcerative colitis 1.600 0.000
ovarian cancer 1.700 0.000

Synonym

Accession Q96RD7 O75968 Q543A0 Q6UW26 Q96AM9 Q96L77 Q96RS5
Symbols PX1
MRS1
UNQ2529

Gene

Protein-protein Interaction (1)

Gene RIF (57)

PMID Text
26823467 Decreased Panx1 function is a response to cell acidification mediated by IFN-gamma-induced up-regulation of Duox2.
26755773 CBX and other inhibitors, including probenecid, attenuate Panx1 channel activity through modulation of the first extracellular loop.
26385361 PANX-1 plays an important role in the release of cytokines and glutamate in a tumor cell line.
26242575 Panx1 channels promote leukocyte adhesion and emigration through the venous wall during acute systemic inflammation.
26098574 Data show that mutation encoding a truncated form of the pannexin-1 (PANX1) channel, PANX1(1-89), as recurrently enriched in highly metastatic breast cancer cells.
26054298 Pannexin1-dependent pathophysiological eATP release in lipoapoptosis is capable of stimulating migration of human monocytes
26009198 Within this review, the regulation of Panx1 channels is discussed, with a focus on how they may contribute to platelet function.
26009197 This review focuses on the known roles of Panx1 related to purinergic signalling in the vasculature focusing on post-translational modifications and channel gating mechanisms that may participate in the regulated release of ATP.
25947940 The frequency of Panx1-400C homozygotes was higher among cardiovascular patients with hyper-reactive platelets. The Panx1-400C variant encodes a gain-of-function channel that enhances collagen-induced ATP release and platelet aggregation.
25301060 Pannexin-1 channel is involved in cigarette smoke-induced ATP release in the lung.
More...

AA Sequence

MAIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPS      1 - 70
SFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLK     71 - 140
FIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLI    141 - 210
IKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN    211 - 280
LVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKV    281 - 350
LENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQR    351 - 420
LLDSSC                                                                    421 - 426
//

Publication (65)

PMID Year Title
26823467 2016 Dual Oxidase 2 (Duox2) Regulates Pannexin 1-mediated ATP Release in Primary Human Airway Epithelial Cells via Changes in Intracellular pH and Not H2O2 Production.
26755773 2016 Carbenoxolone inhibits Pannexin1 channels through interactions in the first extracellular loop.
26385361 2016 Effect of pannexin-1 on the release of glutamate and cytokines in astrocytes.
26242575 2015 Pannexin 1 channels regulate leukocyte emigration through the venous endothelium during acute inflammation.
26098574 2015 Mechanosensitive pannexin-1 channels mediate microvascular metastatic cell survival.
26054298 2015 Lipoapoptosis induced by saturated free fatty acids stimulates monocyte migration: a novel role for Pannexin1 in liver cells.
26009198 2015 Regulation of Pannexin-1 channel activity.
26009197 2015 Emerging concepts regarding pannexin 1 in the vasculature.
25947940 2015 Functional role of a polymorphism in the Pannexin1 gene in collagen-induced platelet aggregation.
25301060 2014 Role of transient receptor potential and pannexin channels in cigarette smoke-triggered ATP release in the lung.
More...