Property Summary

NCBI Gene PubMed Count 63
PubMed Score 367.63
PubTator Score 200.32

Knowledge Summary

Patent (5,254)

Expression

  Differential Expression (10)

Disease log2 FC p
psoriasis 1.200 5.5e-81
cutaneous lupus erythematosus 1.200 5.8e-03
juvenile dermatomyositis 1.530 3.0e-08
lung cancer 1.400 2.6e-04
diabetes mellitus -1.500 1.3e-03
group 3 medulloblastoma 1.200 9.0e-03
aldosterone-producing adenoma -1.022 9.0e-03
invasive ductal carcinoma 1.400 1.9e-03
ulcerative colitis 1.600 1.4e-07
ovarian cancer 1.700 1.6e-04

 CSPA Cell Line (3)

Protein-protein Interaction (1)

Gene RIF (57)

PMID Text
26823467 Decreased Panx1 function is a response to cell acidification mediated by IFN-gamma-induced up-regulation of Duox2.
26755773 CBX and other inhibitors, including probenecid, attenuate Panx1 channel activity through modulation of the first extracellular loop.
26385361 PANX-1 plays an important role in the release of cytokines and glutamate in a tumor cell line.
26242575 Panx1 channels promote leukocyte adhesion and emigration through the venous wall during acute systemic inflammation.
26098574 Data show that mutation encoding a truncated form of the pannexin-1 (PANX1) channel, PANX1(1-89), as recurrently enriched in highly metastatic breast cancer cells.
26054298 Pannexin1-dependent pathophysiological eATP release in lipoapoptosis is capable of stimulating migration of human monocytes
26009198 Within this review, the regulation of Panx1 channels is discussed, with a focus on how they may contribute to platelet function.
26009197 This review focuses on the known roles of Panx1 related to purinergic signalling in the vasculature focusing on post-translational modifications and channel gating mechanisms that may participate in the regulated release of ATP.
25947940 The frequency of Panx1-400C homozygotes was higher among cardiovascular patients with hyper-reactive platelets. The Panx1-400C variant encodes a gain-of-function channel that enhances collagen-induced ATP release and platelet aggregation.
25301060 Pannexin-1 channel is involved in cigarette smoke-induced ATP release in the lung.
25239622 Panx1 and Panx3 are co-expressed in human skeletal muscle myoblasts and play a pivotal role in dictating the proliferation and differentiation.
25170954 These findings indicate that Panx1 participates in urothelial mechanotransduction and signaling by providing a direct pathway for mechanically-induced ATP release and by functionally interacting with P2X7Rs
25112874 Chemotherapeutic drugs also activated an alternative caspase- and Panx1-independent pathway for ATP release from Jurkat cells in the presence of benzyloxycarbonyl-VAD, a pan-caspase inhibitor.
25008946 Data suggest that both up-regulation and down-regulation of expression of pannexins (PANX1, PANX2, PANX3) are associated with disease onset and/or progression; examples include neoplasms, multiple sclerosis, migraine, and hypertension. [REVIEW]
24671093 Pannexin-1 is not involved in the P2X7 mediated uptake of dye in Hek-293 cells.
24655807 Panx1 is expressed on human platelets and amplifies Ca(2+) influx, ATP release and aggregation through the secondary activation of P2X1 receptors.
24646995 data identify a novel linkage between an antibiotic, pannexin channels and cellular integrity, and suggest that re-engineering certain quinolones might help develop newer antibacterials
24531690 These findings suggest that nonmetal hapten reactivity to thiol residues causes membrane disruption of keratinocytes and reactive oxygen species production that leads to ATP release through opening of Panx hemichannels.
24418937 The critical involvement of Panx1 despite its absence in epiplexus cells was while it was not surprising that ATP could activate the epiplexus cells.
24146091 Panx1 and Panx2 expression was detected in the temporal lobe cortex of patients with temporal lobe epilepsy and in the control tissues.
23936165 P2X4 assembles with P2X7 and pannexin-1 in gingival epithelial cells and modulates ATP-induced reactive oxygen species production and inflammasome activation during P. gingivalis infection.
23918924 histamine induces ATP release from human subcutaneous fibroblasts, via pannexin-1 hemichannels, leading to [Ca(2+)]i mobilization and cell growth through the cooperation of H1 and P2 (probably P2Y1) receptors.
23798685 findings suggest that chemoattractant receptors require PANX1 to trigger excitatory and inhibitory signals that synergize to fine-tune chemotactic responses at the front and back of neutrophils
23700432 Panx1 localizes to chlamydial inclusions but its absence does not effect chlamydial development during infection of cells.
23594276 Pannexin-1 immunoreactivity was mainly localized to enteric ganglia, blood vessel endothelium, erythrocytes, epithelial and goblet cells. In ulcerative colitis myenteric ganglia, there was a significant reduction in Panx1.
23549611 Overexpression of Panx1 in THP-1 cells also failed to increase the infl ammasome activity as revealed by similar IL-1beta and caspase-1 activity in comparison with normal THP-1 cells
23456773 Blocking Panx1 hemichannels by reducing their opening or protein expression inhibited HIV replication in CD4(+) T lymphocytes
23033481 S-nitrosylation of Panx1 at Cys-40 and Cys-346 inhibits Panx1 channel currents and ATP release.
22972801 These results suggest that panx1 contributes to pathophysiological ATP release in lipoapoptosis induced by saturated FFA; panx1 may play a role in hepatic inflammation by mediating an increase in extracellular ATP concentration in lipotoxic liver injury.
22947051 Panx1 level is modulated during keratinocyte differentiation and carcinogenesis and reveal distinct localization pattern for Panx1 in human adnexal structures.
22753409 while Panx1 is present in skin melanocytes it is up-regulated during melanoma tumor progression, and tumorigenesis can be inhibited by the knockdown of Panx1 raising the possibility that Panx1 may be a viable target for the treatment of melanoma.
22311983 mechanism of PANX1 channel regulation
22311122 Panx1 assembles into a membrane anion channel with a relatively low single-channel conductance.
21865551 both P2X(7) and Panx-1 are required for GM-CSF promotion of multinucleated macrophages fusion
21859844 ATP is released from HIV-1 target cells through pannexin-1 channels upon interaction between the HIV-1 envelope protein and specific target cell receptors CD4
21791690 MSR1 was significantly associated with the presence of Barrett esophagus/esophageal adenocarcinoma in derivation and validation samples
21659516 indicate that the oligomerization and trafficking of Panx1 are regulated by the C-terminal domain, whereas internalization of long lived Panx1 channels occurs in a manner that is distinct from classical endocytic pathways
21606493 TRPV4 and Rho transduce cell membrane stretch/strain into pannexin 1-mediated ATP release in airway epithelia.
20944749 data identify PANX1 as a plasma membrane channel mediating the regulated release of find-me signals and selective plasma membrane permeability during apoptosis, and a new mechanism of PANX1 activation by caspases
20884646 immunostimulatory effects of hypertonic stress treatment are mediated by the controlled cellular release of ATP through Panx1 hemichannels .
20660288 T-cell receptor stimulation results in the translocation of P2X1 and P2X4 receptors and pannexin-1 hemichannels to the immune synapse.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20622111 Pannexin 1 is the conduit for ATP release from erythrocytes in response to lowered O(2) tension.
20516070 Pannexin1 and Pannexin2 channels show quaternary similarities to connexons and different oligomerization numbers from each other
20086016 although Panx1 and Panx3 share a common endoplasmic reticulum to Golgi secretory pathway to Cx43, their ultimate cell surface residency appears to be independent of cell contacts and the need for intact microtubules
19213873 Pannexin 1 contributes to ATP release in airway epithelia.
19150332 In this study, they investigated whether endogenous panx-1 was activated and contributed to membrane current in osmotically swollen HEK-293 cells.
19056988 It is demonstrated that pannexin-1 is activated by NMDA receptor stimulation and contributes to epileptic like bursting activity in the hippocampus.
18596211 Explored the pharmacological action of compounds known to block gap junctions on Panx1 channels activated by the P2X(7)R and the mechanisms involved in the interaction between these two proteins.
17925379 These studies show that Panx1 and Panx3 have many characteristics that are distinct from Cx43 and that these proteins probably play an important biological role as single membrane channels.
17715132 PANX1 channels contain a glycosylation site that targets the hexamer to the cell membrane.
17240370 pannexin1 appears to be the molecular substrate for the permeabilization pore (or death receptor channel) recruited into the P2X(7)R signaling complex
17036048 pannexin-1 is required for processing of caspase-1 and release of mature IL-1beta induced by P2X(7) receptor activation.
17036048 Panx1 in the plasma membrane of the macrophage couples to the purinergic P2X7 receptor and permeabilize the macrophage membrane, this signaling is required for the processing and release of interleukin-1beta in response to P2X7 receptor activation.
16908669 Overexpression of PanX1 results in the formation of Ca(2+)-permeable gap junction channels between adjacent cells, thus, allowing direct intercellular Ca(2+) diffusion and facilitating intercellular Ca(2+) wave propagation.
16690868 Pannexin-1 in pyramidal neurons is activated by ischemia and may play an important role ionic dysregulation
16682648 Data show that erythrocytes express the gap junction protein pannexin 1.

AA Sequence

MAIAQLATEYVFSDFLLKEPTEPKFKGLRLELAVDKMVTCIAVGLPLLLISLAFAQEISIGTQISCFSPS      1 - 70
SFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFFPYILLLFAILLYLPPLFWRFAAAPHICSDLK     71 - 140
FIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLI    141 - 210
IKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN    211 - 280
LVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKV    281 - 350
LENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQR    351 - 420
LLDSSC                                                                    421 - 426
//

Text Mined References (65)

PMID Year Title
26823467 2016 Dual Oxidase 2 (Duox2) Regulates Pannexin 1-mediated ATP Release in Primary Human Airway Epithelial Cells via Changes in Intracellular pH and Not H2O2 Production.
26755773 2016 Carbenoxolone inhibits Pannexin1 channels through interactions in the first extracellular loop.
26385361 2016 Effect of pannexin-1 on the release of glutamate and cytokines in astrocytes.
26242575 2015 Pannexin 1 channels regulate leukocyte emigration through the venous endothelium during acute inflammation.
26098574 2015 Mechanosensitive pannexin-1 channels mediate microvascular metastatic cell survival.
26054298 2015 Lipoapoptosis induced by saturated free fatty acids stimulates monocyte migration: a novel role for Pannexin1 in liver cells.
26009198 2015 Regulation of Pannexin-1 channel activity.
26009197 2015 Emerging concepts regarding pannexin 1 in the vasculature.
25947940 2015 Functional role of a polymorphism in the Pannexin1 gene in collagen-induced platelet aggregation.
25301060 2014 Role of transient receptor potential and pannexin channels in cigarette smoke-triggered ATP release in the lung.
25239622 2014 Pannexin 1 and pannexin 3 channels regulate skeletal muscle myoblast proliferation and differentiation.
25170954 2014 Pannexin 1 channels play essential roles in urothelial mechanotransduction and intercellular signaling.
25112874 2014 Chemotherapeutic drugs induce ATP release via caspase-gated pannexin-1 channels and a caspase/pannexin-1-independent mechanism.
25008946 2014 Pannexin channels and their links to human disease.
24671093 2014 Probenecid blocks human P2X7 receptor-induced dye uptake via a pannexin-1 independent mechanism.
24655807 2014 Amplification of human platelet activation by surface pannexin-1 channels.
24646995 2014 Unexpected link between an antibiotic, pannexin channels and apoptosis.
24531690 2014 Nonmetal haptens induce ATP release from keratinocytes through opening of pannexin hemichannels by reactive oxygen species.
24418937 2014 A critical role for pannexin-1 in activation of innate immune cells of the choroid plexus.
24146091 2013 Altered expression of pannexin proteins in patients with temporal lobe epilepsy.
23936165 2013 P2X4 assembles with P2X7 and pannexin-1 in gingival epithelial cells and modulates ATP-induced reactive oxygen species production and inflammasome activation.
23918924 2013 Histamine induces ATP release from human subcutaneous fibroblasts, via pannexin-1 hemichannels, leading to Ca2+ mobilization and cell proliferation.
23798685 2013 Pannexin 1 channels link chemoattractant receptor signaling to local excitation and global inhibition responses at the front and back of polarized neutrophils.
23700432 2013 Assessing a potential role of host Pannexin 1 during Chlamydia trachomatis infection.
23594276 2013 Expression and localization of pannexin-1 hemichannels in human colon in health and disease.
23549611 2013 Pannexin-1 influences peritoneal cavity cell population but is not involved in NLRP3 inflammasome activation.
23456773 2013 Pannexin1 hemichannels are critical for HIV infection of human primary CD4+ T lymphocytes.
23033481 2012 S-nitrosylation inhibits pannexin 1 channel function.
22972801 2012 Pannexin1 contributes to pathophysiological ATP release in lipoapoptosis induced by saturated free fatty acids in liver cells.
22947051 2012 Pannexin1 and Pannexin3 exhibit distinct localization patterns in human skin appendages and are regulated during keratinocyte differentiation and carcinogenesis.
22753409 2012 Loss of pannexin 1 attenuates melanoma progression by reversion to a melanocytic phenotype.
22311983 2012 Pannexin 1, an ATP release channel, is activated by caspase cleavage of its pore-associated C-terminal autoinhibitory region.
22311122 2012 Pannexin 1 forms an anion-selective channel.
21865551 2011 The P2X7 receptor and Pannexin-1 are both required for the promotion of multinucleated macrophages by the inflammatory cytokine GM-CSF.
21791690 2011 Germline mutations in MSR1, ASCC1, and CTHRC1 in patients with Barrett esophagus and esophageal adenocarcinoma.
21659516 2011 Pathways regulating the trafficking and turnover of pannexin1 protein and the role of the C-terminal domain.
21606493 2011 Rho signaling regulates pannexin 1-mediated ATP release from airway epithelia.
20944749 2010 Pannexin 1 channels mediate 'find-me' signal release and membrane permeability during apoptosis.
20884646 2010 Hypertonic stress regulates T cell function via pannexin-1 hemichannels and P2X receptors.
20829356 2010 Intracellular cysteine 346 is essentially involved in regulating Panx1 channel activity.
20660288 2010 Pannexin-1 hemichannel-mediated ATP release together with P2X1 and P2X4 receptors regulate T-cell activation at the immune synapse.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20622111 2010 Pannexin 1 is the conduit for low oxygen tension-induced ATP release from human erythrocytes.
20516070 2010 Pannexin1 and Pannexin2 channels show quaternary similarities to connexons and different oligomerization numbers from each other.
20086016 2010 Pannexin1 and pannexin3 delivery, cell surface dynamics, and cytoskeletal interactions.
19946888 2010 Defining the membrane proteome of NK cells.
19213873 2009 Pannexin 1 contributes to ATP release in airway epithelia.
19150332 2009 Lack of coupling between membrane stretching and pannexin-1 hemichannels.
19056988 2008 Activation of pannexin-1 hemichannels augments aberrant bursting in the hippocampus.
18596211 2008 P2X7 receptor-Pannexin1 complex: pharmacology and signaling.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17925379 2007 Pannexin 1 and pannexin 3 are glycoproteins that exhibit many distinct characteristics from the connexin family of gap junction proteins.
17715132 2007 Pannexin1 channels contain a glycosylation site that targets the hexamer to the plasma membrane.
17240370 2007 Pannexin1 is part of the pore forming unit of the P2X(7) receptor death complex.
17036048 2006 Pannexin-1 mediates large pore formation and interleukin-1beta release by the ATP-gated P2X7 receptor.
16908669 2006 Functional implications of calcium permeability of the channel formed by pannexin 1.
16690868 2006 Ischemia opens neuronal gap junction hemichannels.
16682648 2006 Pannexin 1 in erythrocytes: function without a gap.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15028292 2004 The mammalian pannexin family is homologous to the invertebrate innexin gap junction proteins.
14597722 2003 Pannexins, a family of gap junction proteins expressed in brain.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.