Property Summary

NCBI Gene PubMed Count 19
Grant Count 9
Funding $1,190,898.18
PubMed Score 52.34
PubTator Score 27.97

Knowledge Summary

Patent (3,286)

Expression

Gene RIF (9)

PMID Text
25773474 There is dense expression of Panx2 in the enteric nervous system. The substantial increase in Panx2 mRNA in ulcerative colitis (UC) muscle but not protein suggests that the Panx2 translation process may be disrupted in UC.
25008946 Data suggest that both up-regulation and down-regulation of expression of pannexins (PANX1, PANX2, PANX3) are associated with disease onset and/or progression; examples include neoplasms, multiple sclerosis, migraine, and hypertension. [REVIEW]
24146091 Panx1 and Panx2 expression was detected in the temporal lobe cortex of patients with temporal lobe epilepsy and in the control tissues.
20516070 Pannexin1 and Pannexin2 channels show quaternary similarities to connexons and different oligomerization numbers from each other
20198315 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19749789 Pannexin2 is a tumor suppressor gene in C6 glioma cells.
17427027 These data do not suggest that Panx2 or Cx36 could increase the risk of schizophrenia in the Japanese population.
16989724 According to brain cancer gene expression database REMBRANDT, PANX2 expression levels can predict post diagnosis survival for patients with glial tumors.

AA Sequence

MHHLLEQSADMATALLAGEKLRELILPGAQDDKAGALAALLLQLKLELPFDRVVTIGTVLVPILLVTLVF      1 - 70
TKNFAEEPIYCYTPHNFTRDQALYARGYCWTELRDALPGVDASLWPSLFEHKFLPYALLAFAAIMYVPAL     71 - 140
GWEFLASTRLTSELNFLLQEIDNCYHRAAEGRAPKIEKQIQSKGPGITEREKREIIENAEKEKSPEQNLF    141 - 210
EKYLERRGRSNFLAKLYLARHVLILLLSAVPISYLCTYYATQKQNEFTCALGASPDGAAGAGPAVRVSCK    211 - 280
LPSVQLQRIIAGVDIVLLCVMNLIILVNLIHLFIFRKSNFIFDKLHKVGIKTRRQWRRSQFCDINILAMF    281 - 350
CNENRDHIKSLNRLDFITNESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEP    351 - 420
PVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATDTLIAPLLDRSAHHYKGGGGD    421 - 490
PGPGPAPAPAPPPAPDKKHARHFSLDVHPYILGTKKAKAEAVPAALPASRSQEGGFLSQAEDCGLGLAPA    491 - 560
PIKDAPLPEKEIPYPTEPARAGLPSGGPFHVRSPPAAPAVAPLTPASLGKAEPLTILSRNATHPLLHINT    561 - 630
LYEAREEEDGGPRLPQDVGDLIAIPAPQQILIATFDEPRTVVSTVEF                           631 - 677
//

Publication (20)

PMID Year Title
25773474 2015 Pannexin-2 is expressed in the human colon with extensive localization in the enteric nervous system.
25008946 2014 Pannexin channels and their links to human disease.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24146091 2013 Altered expression of pannexin proteins in patients with temporal lobe epilepsy.
20516070 2010 Pannexin1 and Pannexin2 channels show quaternary similarities to connexons and different oligomerization numbers from each other.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19749789 2009 Pannexin2 as a novel growth regulator in C6 glioma cells.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17427027 2007 Gap junction coding genes and schizophrenia: a genetic association study.
More...