Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (136)

Gene RIF (1)

20677014 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

YVVVPPTLNPVIYGVRTKHIRETVLRIFFKTDH                                         281 - 313

Publication (3)

PMID Year Title
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.