Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (136)


  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Gene RIF (1)

AA Sequence

YVVVPPTLNPVIYGVRTKHIRETVLRIFFKTDH                                         281 - 313

Text Mined References (3)

PMID Year Title