Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09
PubTator Score 0.10

Knowledge Summary

Patent (113)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Atrophic gastritis 5 3.261 1.6

Gene RIF (1)

AA Sequence

MRNHTEITEFILLGLTDDPNFQVVIFVFLLITYMLSITGNLTLITITLLDSHLQTPMYFFLRNFSILEIS      1 - 70
FTTVSIPKFLGNIISGDKTISFNNCIVQLFFFILLGVTEFYLLAAMSYDRYVAICKPLHCLSIMNRRVCT     71 - 140
LLVFTSWLVSFLIIFPALMLLLKLHYCRSNIIDHFTCDYFPLLQLACSDTKFLEVMGFSCAAFTLMFTLA    141 - 210
LIFLSYIYIIRTILRIPSTSQRTKAFSTCSSHMVVVSISYGSCIFMYIKPSAKDRVSLSKGVAILNTSVA    211 - 280
PMMNPFIYSLRNQQVKQAFINMARKTVFFTST                                          281 - 312
//

Text Mined References (6)

PMID Year Title