Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (141)


  Disease Relevance (1)

Disease Z-score Confidence
non primary Sjogren syndrome sicca 840

AA Sequence

VPMLNPLIYSLRNKDVKVALRKALIKIQRRNIF                                         281 - 313

Publication (3)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.