Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Relevance (2)

Disease Z-score Confidence
Multiple Sclerosis 496
diabetes mellitus 1,663


AA Sequence

TPVMNPLIYSLRNKDIKGALVKVVAVKFFSVQ                                          281 - 312

Publication (4)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9653642 1998 A transcriptional Map of the FMF region.
1370859 1992 Expression of members of the putative olfactory receptor gene family in mammalian germ cells.