Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
Multiple Sclerosis 540 1.4e-04
diabetes mellitus 1728 3.6e-03


  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.700 3.6e-03
Multiple Sclerosis 3.100 1.4e-04

AA Sequence

TPVMNPLIYSLRNKDIKGALVKVVAVKFFSVQ                                          281 - 312

Text Mined References (4)

PMID Year Title