Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03

Expression

AA Sequence

MAWSNQSAVTEFILRGLSSSLELQIFYFLFFSIVYAATVLGNLLIVVTIASEPHLHSPMYFLLGNLSFID      1 - 70
MSLASFATPKMIADFLREHKAISFEGCMTQMFFLHLLGGAEIVLLISMSFDRYVAICKPLHYLTIMSRRM     71 - 140
CVGLVILSWIVGIFHALSQLAFTVNLPFCGPNEVDSFFCDLPLVIKLACVDTYILGVFMISTSGMIALVC    141 - 210
FILLVISYTIILVTVRQRSSGGSSKALSTCSAHFTVVTLFFGPCTFIYVWPFTNFPIDKVLSVFYTIYTP    211 - 280
LLNPVIYTVRNKDVKYSMRKLSSHIFKSRKTDHTP                                       281 - 315
//

Text Mined References (4)

PMID Year Title