Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

AA Sequence

MAWSNQSAVTEFILRGLSSSLELQIFYFLFFSIVYAATVLGNLLIVVTIASEPHLHSPMYFLLGNLSFID      1 - 70
MSLASFATPKMIADFLREHKAISFEGCMTQMFFLHLLGGAEIVLLISMSFDRYVAICKPLHYLTIMSRRM     71 - 140
CVGLVILSWIVGIFHALSQLAFTVNLPFCGPNEVDSFFCDLPLVIKLACVDTYILGVFMISTSGMIALVC    141 - 210
FILLVISYTIILVTVRQRSSGGSSKALSTCSAHFTVVTLFFGPCTFIYVWPFTNFPIDKVLSVFYTIYTP    211 - 280
LLNPVIYTVRNKDVKYSMRKLSSHIFKSRKTDHTP                                       281 - 315
//

Publication (4)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12730696 2003 Different noses for different people.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.