Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent (358)


  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

FNPMLNPLIYSLRNAEVKGALKRVLWKQRSK                                           281 - 311

Publication (6)

PMID Year Title
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
9500546 1998 Distribution of olfactory receptor genes in the human genome.