Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 2.60

Knowledge Summary

Patent (144)

AA Sequence

NPMLNPLIYSLRNAEVKGALRRALRKERLT                                            281 - 310

Publication (4)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.