Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.13
PubTator Score 2.60

Knowledge Summary

Patent (144)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Pulmonary edema 17 3.15 1.6

AA Sequence

MEGNKTWITDITLPRFQVGPALEILLCGLFSAFYTLTLLGNGVIFGIICLDCKLHTPMYFFLSHLAIVDI      1 - 70
SYASNYVPKMLTNLMNQESTISFFPCIMQTFLYLAFAHVECLILVVMSYDRYADICHPLRYNSLMSWRVC     71 - 140
TVLAVASWVFSFLLALVPLVLILSLPFCGPHEINHFFCEILSVLKLACADTWLNQVVIFAACVFILVGPL    141 - 210
CLVLVSYLRILAAILRIQSGEGRRKAFSTCSSHLCVVGLFFGSAIVTYMAPKSRHPEEQQKVLSLFYSLF    211 - 280
NPMLNPLIYSLRNAEVKGALRRALRKERLT                                            281 - 310
//

Text Mined References (4)

PMID Year Title