Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (224)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
diabetes mellitus 1663 0.00184601589683304

Synonym

Accession Q96R30 Q6IFL6 Q8NGV1
Symbols OR2V3
OST713

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Mouse EggNOG Inparanoid
Rat OMA EggNOG
Rat OMA Inparanoid
Cow EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid

AA Sequence

METWVNQSYTDGFFLLGIFSHSTADLVLFSVVMAVFTVALCGNVLLIFLIYMDPHLHTPMYFFLSQLSLM      1 - 70
DLMLVCTNVPKMAANFLSGRKSISFVGCGIQIGLFVCLVGSEGLLLGLMAYDRYVAISHPLHYPILMNQR     71 - 140
VCLQITGSSWAFGIIDGLIQMVVVMNFPYCGLRKVNHFFCEMLSLLKLACVDTSLFEKVIFACCVFMLLF    141 - 210
PFSIIVASYAHILGTVLQMHSAQAWKKALATCSSHLTAVTLFYGAAMFIYLRPRHYRAPSHDKVASIFYT    211 - 280
VLTPMLNPLIYSLRNREVMGALRKGLDRCRIGSQH                                       281 - 315
//

Text Mined References (2)

PMID Year Title
14983052 2004 The human olfactory receptor gene family.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.