Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent (224)

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.8e-03

AA Sequence

METWVNQSYTDGFFLLGIFSHSTADLVLFSVVMAVFTVALCGNVLLIFLIYMDPHLHTPMYFFLSQLSLM      1 - 70
DLMLVCTNVPKMAANFLSGRKSISFVGCGIQIGLFVCLVGSEGLLLGLMAYDRYVAISHPLHYPILMNQR     71 - 140
VCLQITGSSWAFGIIDGLIQMVVVMNFPYCGLRKVNHFFCEMLSLLKLACVDTSLFEKVIFACCVFMLLF    141 - 210
PFSIIVASYAHILGTVLQMHSAQAWKKALATCSSHLTAVTLFYGAAMFIYLRPRHYRAPSHDKVASIFYT    211 - 280
VLTPMLNPLIYSLRNREVMGALRKGLDRCRIGSQH                                       281 - 315
//

Text Mined References (2)

PMID Year Title