Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 2.00

Knowledge Summary

Patent (117)

AA Sequence

MAWENQTFNSDFILLGIFNHSPPHTFLFFLVLGIFLVAFMGNSVMVLLIYLDTQLHTPMYFLLSQLSLMD      1 - 70
LMLICTTVPKMAFNYLSGSKSISMAGCVTQIFFYISLSGSECFLLAVMAYDRYIAICHPLRYTNLMNPKI     71 - 140
CGLMATFSWILGSTDGIIDAVATFSFSFCGSREIAHFFCEFPSLLILSCNDTSIFEEVIFICCIVMLVFP    141 - 210
VAIIIASYARVILAVIHMGSGEGRCKAFTTCSSHLMVVGMYYGAALFMYIRPTSDHSPTQDKMVSVFYTI    211 - 280
LTPMLNPLIYSLRNKEVTRAFMKILGKGKSESELPHKLYVLLFAKFFFLISIFFYDVKILALIMYIA       281 - 347
//

Publication (2)

PMID Year Title
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.