Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.26
PubTator Score 4.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Gene RIF (1)

AA Sequence

MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEE      1 - 70
FDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA           71 - 134
//

Text Mined References (7)

PMID Year Title