Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.56
PubTator Score 4.56

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
12177003 Human CRBP IV belongs to a clearly distinct CRBP subfamily and suggest a relatively different mode of retinol binding for this binding protein.

AA Sequence

MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEE      1 - 70
FDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA           71 - 134
//

Text Mined References (7)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12177003 2002 Ligand binding and structural analysis of a human putative cellular retinol-binding protein.