Property Summary

NCBI Gene PubMed Count 6
PubMed Score 5.56
PubTator Score 4.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 7.19240632575369E-29
breast carcinoma 1614 4.26561521028128E-18
ovarian cancer 8492 3.09782429794551E-9
non-small cell lung cancer 2798 1.57165980853844E-6
tuberculosis 1563 3.36171046546719E-6
psoriasis 6685 3.82043162267395E-6
osteosarcoma 7933 4.49806178987656E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.77566145080626E-5
invasive ductal carcinoma 2950 1.08492591835308E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 1.28693905524209E-4
ductal carcinoma in situ 1745 1.77245525154684E-4
ependymoma 2514 5.07721417036409E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00109343129910255
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00319642018703403
Pick disease 1893 0.00959977213908468
pediatric high grade glioma 2712 0.0162022679504042
Breast cancer 3099 0.02529572604829
group 4 medulloblastoma 1875 0.033161499789048
progressive supranuclear palsy 674 0.035555324582358
mucosa-associated lymphoid tissue lymphoma 480 0.0362395523953131
Disease Target Count Z-score Confidence
Scimitar syndrome 6 4.203 2.1

Expression

Synonym

Accession Q96R05 B2R517 Q5SWJ4
Symbols CRBP4
CRABP4
CRBPIV

Gene

PDB

1LPJ  

  Ortholog (8)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
12177003 Human CRBP IV belongs to a clearly distinct CRBP subfamily and suggest a relatively different mode of retinol binding for this binding protein.

AA Sequence

MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEE      1 - 70
FDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA           71 - 134
//

Text Mined References (7)

PMID Year Title
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12177003 2002 Ligand binding and structural analysis of a human putative cellular retinol-binding protein.