Property Summary

NCBI Gene PubMed Count 48
PubMed Score 12.00
PubTator Score 43.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adrenocortical carcinoma 1.020 1.5e-03
adult high grade glioma -2.100 1.5e-05
Astrocytoma, Pilocytic -1.900 1.5e-07
atypical teratoid / rhabdoid tumor -2.200 4.5e-04
Breast cancer -1.300 9.7e-10
cutaneous lupus erythematosus -1.100 4.0e-02
ductal carcinoma in situ -1.100 7.3e-03
ependymoma -2.800 5.6e-20
gastric carcinoma -1.200 4.9e-02
glioblastoma -1.500 5.5e-06
intraductal papillary-mucinous adenoma (... 1.400 3.0e-04
intraductal papillary-mucinous carcinoma... 1.100 5.9e-03
invasive ductal carcinoma -1.200 1.1e-03
lung adenocarcinoma -1.200 9.5e-18
medulloblastoma -1.300 2.4e-03
medulloblastoma, large-cell -1.800 6.1e-04
non-small cell lung cancer -1.487 5.5e-19
ovarian cancer -1.200 8.8e-05
pituitary cancer 1.100 4.1e-02
psoriasis -1.800 1.0e-03
subependymal giant cell astrocytoma -1.976 1.1e-02

PDB (12)

Gene RIF (23)

AA Sequence

MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELL      1 - 70
LEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRFQKGSPDHELQQTIRDNLYRH     71 - 140
AVPCTTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVGTYEGNYYGTPKPPSQPVSGKVITTDALHSL    141 - 210
QSGSKQSTPKRTKSYNDMQNAGIVHAENEEEDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPI    211 - 280
TDPSQKFPQYLPLSAEDNLGPLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGV    281 - 350
HTEELDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQQQQQQQQQQQQQ    351 - 420
QTEEWTEDHSALVPPVIPNHPPSNPEPAREVPLQGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGD    421 - 490
EPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPF    491 - 560
DPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTGKVNGMKDARPSSPADVASNSSHGYPNDTVS    561 - 630
LASSIATQPELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHN    631 - 700
QVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEF    701 - 770
PPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQ    771 - 840
DIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQ    841 - 910
AAKQGHVNLTVRRKVVFAVPKTENEVPSPASSHHSSNQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIG    911 - 980
SGGGGGSGVVSTVVQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFAGNACVAMPHKIGRIIEGSPADRC    981 - 1050
GKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQ   1051 - 1120
GTQETRNTTKPKQESQFEFKAPQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERC   1121 - 1190
GKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLFLKRGDGSVPEYDPSSDRHGPATGPQGVPEVR   1191 - 1260
AGPDRRQHPSLESSYPPDLHKSSPHGEKRAHARDPKGSREYSRQPNEHHTWNGTSRKPDSGACRPKDRAP   1261 - 1330
EGRRDAQAERAAAANGPKRRSPEKRREGTRSADNTLERREKHEKRRDVSPERRRERSPTRRRDGSPSRRR   1331 - 1400
RSLERLLEQRRSPERRRGGSPERRAKSTDRRRARSPERRRERSLDKRNREDRASHREREEANLKQDAGRS   1401 - 1470
SRHPPEQRRRPYKECSTDLSI                                                    1471 - 1491
//

Text Mined References (55)

PMID Year Title