Property Summary

NCBI Gene PubMed Count 46
Grant Count 32
R01 Count 27
Funding $1,839,051.84
PubMed Score 9.00
PubTator Score 43.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (21)

PMID Text
25993607 MAGI1 rs35855737 is a novel locus for neuroticism. [Meta-Analysis]
25990289 A deletion at ADAMTS9-MAGI1 locus is associated with psoriatic arthritis risk.
25557950 Variants in MAGI1 were associated with a Crohn's disease phenotype involving a complicated stricturing disease course.
22911767 The data suggests that inactivation of MAGI-1 by the NS1 protein from avian influenza A virus elicits an interferon-beta induction signal.
22718816 The PDZ1 and PDZ3 domains of MAGI-1 regulate the eight-exon isoform of the CXADR-like membrane protein.
22381734 Results presented herein provide further evidence for a role of MAGI1 in bipolar affective disorder and schizophrenia etiology.
21942217 MAGI1 expression is decreased in hepatocellular carcinoma, which correlates with poor prognosis, suggesting MAGI1 as a novel prognostic marker
21685691 MAGI1 may inhibit the cancer cell migration and invasion of hepatocellular carcinoma via regulating PTEN.
21489588 HPV16 E6 association with PDZ domain-containing proteins, MAGI1, Dlg1 or Scrib, stabilized the levels of E6.
21238461 Mutations designed in the C-terminal flanking region of the human MAGI-1 PDZ domain resulted in a significant decrease in binding affinity for human papillomavirus E6 peptides.
More...

AA Sequence

MSKVIQKKNHWTSRVHECTVKRGPQGELGVTVLGGAEHGEFPYVGAVAAVEAAGLPGGGEGPRLGEGELL      1 - 70
LEVQGVRVSGLPRYDVLGVIDSCKEAVTFKAVRQGGRLNKDLRHFLNQRFQKGSPDHELQQTIRDNLYRH     71 - 140
AVPCTTRSPREGEVPGVDYNFLTVKEFLDLEQSGTLLEVGTYEGNYYGTPKPPSQPVSGKVITTDALHSL    141 - 210
QSGSKQSTPKRTKSYNDMQNAGIVHAENEEEDDVPEMNSSFTADSGEQEEHTLQETALPPVNSSIIAAPI    211 - 280
TDPSQKFPQYLPLSAEDNLGPLPENWEMAYTENGEVYFIDHNTKTTSWLDPRCLNKQQKPLEECEDDEGV    281 - 350
HTEELDSELELPAGWEKIEDPVYGIYYVDHINRKTQYENPVLEAKRKKQLEQQQQQQQQQQQQQQQQQQQ    351 - 420
QTEEWTEDHSALVPPVIPNHPPSNPEPAREVPLQGKPFFTRNPSELKGKFIHTKLRKSSRGFGFTVVGGD    421 - 490
EPDEFLQIKSLVLDGPAALDGKMETGDVIVSVNDTCVLGHTHAQVVKIFQSIPIGASVDLELCRGYPLPF    491 - 560
DPDDPNTSLVTSVAILDKEPIIVNGQETYDSPASHSSKTGKVNGMKDARPSSPADVASNSSHGYPNDTVS    561 - 630
LASSIATQPELITVHIVKGPMGFGFTIADSPGGGGQRVKQIVDSPRCRGLKEGDLIVEVNKKNVQALTHN    631 - 700
QVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEF    701 - 770
PPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPSPASGLSKGEREREINSTNFGECPIPDYQEQ    771 - 840
DIFLWRKETGFGFRILGGNEPGEPIYIGHIVPLGAADTDGRLRSGDELICVDGTPVIGKSHQLVVQLMQQ    841 - 910
AAKQGHVNLTVRRKVVFAVPKTENEVPSPASSHHSSNQPASLTEEKRTPQGSQNSLNTVSSGSGSTSGIG    911 - 980
SGGGGGSGVVSTVVQPYDVEIRRGENEGFGFVIVSSVSRPEAGTTFAGNACVAMPHKIGRIIEGSPADRC    981 - 1050
GKLKVGDRILAVNGCSITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQ   1051 - 1120
GTQETRNTTKPKQESQFEFKAPQATQEQDFYTVELERGAKGFGFSLRGGREYNMDLYVLRLAEDGPAERC   1121 - 1190
GKMRIGDEILEINGETTKNMKHSRAIELIKNGGRRVRLFLKRGDGSVPEYDPSSDRHGPATGPQGVPEVR   1191 - 1260
AGPDRRQHPSLESSYPPDLHKSSPHGEKRAHARDPKGSREYSRQPNEHHTWNGTSRKPDSGACRPKDRAP   1261 - 1330
EGRRDAQAERAAAANGPKRRSPEKRREGTRSADNTLERREKHEKRRDVSPERRRERSPTRRRDGSPSRRR   1331 - 1400
RSLERLLEQRRSPERRRGGSPERRAKSTDRRRARSPERRRERSLDKRNREDRASHREREEANLKQDAGRS   1401 - 1470
SRHPPEQRRRPYKECSTDLSI                                                    1471 - 1491
//

Text Mined References (53)

PMID Year Title
25993607 2015 Meta-analysis of Genome-wide Association Studies for Neuroticism, and the Polygenic Association With Major Depressive Disorder.
25990289 2015 A deletion at ADAMTS9-MAGI1 locus is associated with psoriatic arthritis risk.
25557950 2015 Identification of risk loci for Crohn's disease phenotypes using a genome-wide association study.
24561201 2014 Mislocalization of K+ channels causes the renal salt wasting in EAST/SeSAME syndrome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24204828 2013 Genome-wide contribution of genotype by environment interaction to variation of diabetes-related traits.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22911767 2012 Regulation of interferon-? by MAGI-1 and its interaction with influenza A virus NS1 protein with ESEV PBM.
More...