Property Summary

NCBI Gene PubMed Count 9
Grant Count 7
Funding $386,569.55
PubMed Score 41.87
PubTator Score 18.80

Knowledge Summary

Patent (2,393)

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 4.036 0.037

Gene RIF (7)

PMID Text
26263540 Panx3 hemichannel is expressed in human odontoblast-like cells and mediates ATP release into the extracellular space.
25239622 Panx1 and Panx3 are co-expressed in human skeletal muscle myoblasts and play a pivotal role in dictating the proliferation and differentiation.
25008946 Data suggest that both up-regulation and down-regulation of expression of pannexins (PANX1, PANX2, PANX3) are associated with disease onset and/or progression; examples include neoplasms, multiple sclerosis, migraine, and hypertension. [REVIEW]
22947051 The 70 kDa immunoreactive species of Panx3 highly regulated during keratinocyte differentiation was shown to most likely correspond to another Panx3 isoform.
20404334 Panx3 functions to switch the chondrocyte cell fate from proliferation to differentiation by regulating the intracellular ATP/cAMP levels
20086016 although Panx1 and Panx3 share a common endoplasmic reticulum to Golgi secretory pathway to Cx43, their ultimate cell surface residency appears to be independent of cell contacts and the need for intact microtubules
17925379 These studies show that Panx1 and Panx3 have many characteristics that are distinct from Cx43 and that these proteins probably play an important biological role as single membrane channels.

AA Sequence

MSLAHTAAEYMLSDALLPDRRGPRLKGLRLELPLDRIVKFVAVGSPLLLMSLAFAQEFSSGSPISCFSPS      1 - 70
NFSIRQAAYVDSSCWDSLLHHKQDGPGQDKMKSLWPHKALPYSLLALALLMYLPVLLWQYAAVPALSSDL     71 - 140
LFIISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLLERYLACKQRSHSLVATYL    141 - 210
LRNSLLLIFTSATYLYLGHFHLDVFFQEEFSCSIKTGLLSDETHVPNLITCRLTSLSIFQIVSLSSVAIY    211 - 280
TILVPVIIYNLTRLCRWDKRLLSVYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLC    281 - 350
VLKDTTTQKHNIDTVVDFMTLLAGLEPSKPKHLTNSACDEHP                                351 - 392
//

Text Mined References (9)

PMID Year Title
26263540 2015 Expression of Pannexin3 in human odontoblast-like cells and its hemichannel function in mediating ATP release.
25239622 2014 Pannexin 1 and pannexin 3 channels regulate skeletal muscle myoblast proliferation and differentiation.
25008946 2014 Pannexin channels and their links to human disease.
22947051 2012 Pannexin1 and Pannexin3 exhibit distinct localization patterns in human skin appendages and are regulated during keratinocyte differentiation and carcinogenesis.
20404334 2010 Pannexin 3 regulates intracellular ATP/cAMP levels and promotes chondrocyte differentiation.
20086016 2010 Pannexin1 and pannexin3 delivery, cell surface dynamics, and cytoskeletal interactions.
17925379 2007 Pannexin 1 and pannexin 3 are glycoproteins that exhibit many distinct characteristics from the connexin family of gap junction proteins.
15028292 2004 The mammalian pannexin family is homologous to the invertebrate innexin gap junction proteins.
14597722 2003 Pannexins, a family of gap junction proteins expressed in brain.