Property Summary

NCBI Gene PubMed Count 13
PubMed Score 44.96
PubTator Score 18.80

Knowledge Summary

Patent (2,393)

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 3.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Pontocerebellar hypoplasia 36 3.034 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 4.036 3.7e-02

Gene RIF (11)

AA Sequence

MSLAHTAAEYMLSDALLPDRRGPRLKGLRLELPLDRIVKFVAVGSPLLLMSLAFAQEFSSGSPISCFSPS      1 - 70
NFSIRQAAYVDSSCWDSLLHHKQDGPGQDKMKSLWPHKALPYSLLALALLMYLPVLLWQYAAVPALSSDL     71 - 140
LFIISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLLERYLACKQRSHSLVATYL    141 - 210
LRNSLLLIFTSATYLYLGHFHLDVFFQEEFSCSIKTGLLSDETHVPNLITCRLTSLSIFQIVSLSSVAIY    211 - 280
TILVPVIIYNLTRLCRWDKRLLSVYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLC    281 - 350
VLKDTTTQKHNIDTVVDFMTLLAGLEPSKPKHLTNSACDEHP                                351 - 392
//

Text Mined References (13)

PMID Year Title