Property Summary

NCBI Gene PubMed Count 62
PubMed Score 58.57
PubTator Score 62.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Infant length 11
Liver carcinoma 217
Disease Target Count P-value
non-small cell lung cancer 2798 8.87247271660406E-25
lung carcinoma 2844 7.37547967652013E-24
lung adenocarcinoma 2714 8.78080239718485E-20
glioblastoma multiforme 347 1.73617514806892E-11
ovarian cancer 8492 2.78676843161008E-11
cystic fibrosis 1670 1.44250094130179E-5
interstitial cystitis 2299 2.60884862894173E-5
pilocytic astrocytoma 3086 8.03451558458002E-5
adrenocortical carcinoma 1427 6.4857141104951E-4
group 4 medulloblastoma 1875 0.00399729369708134
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00450142104365526
atypical teratoid / rhabdoid tumor 4369 0.011847014221173
astrocytic glioma 2241 0.0134546196003173
ependymoma 2514 0.0149950529874139
subependymal giant cell astrocytoma 2287 0.0172888753356184
progressive supranuclear palsy 674 0.0173612354077888
Pick disease 1893 0.0201263647389281
oligodendroglioma 2849 0.0212055204933937
Endometriosis 535 0.0344930066484466
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.04656431171545
Disease Target Count Z-score Confidence
Chondrodysplasia Blomstrand type 3 4.598 2.3
Holoprosencephaly 52 3.431 1.7

Expression

  Differential Expression (20)

Synonym

Accession Q96QV1 Q6PK09 Q8NCI7 Q9BXK3 Q9H1J4 Q9H7E7 HHIP
Symbols HIP

Gene

PDB

2WFT   2WFX   2WG3   2WG4   3HO3   3HO4   3HO5  

  Ortholog (13)

 IMPC Term (1)

 CSPA Cell Line (2)

Gene RIF (43)

PMID Text
26527870 HHIP - candidate gene for Chronic Obstructive Pulmonary Disease identified by Genome-wide association studies.
25416442 HHIP might be a diagnostic or prognostic marker in glioma and help to the detection of these tumors in early stages of disease.
25215859 Shh-mediated degradation of Hhip allows cell autonomous and non-cell autonomous Shh signaling.
25006744 HHIP is located within genes previously associated with chronic obstructive pulmonary disease susceptibility.
24439425 We show that GPC3, an hepatocellular carcinoma biomarker and Hh mediator, regulates human stellate cell viability by regulating Hh signaling.
23994291 our study suggests that the HHIP gene may be involved in COPD susceptibility in Chinese Han population.
23935859 Data indicate that the Shh signaling transduction is facilitated by binding of Shh to its receptor protein, Ptch, and show the complex structure of Shh-Hhip.
23780909 These data suggest that activated Hedgehog signalling contributes to the biology of human fetal rhabdomyomas.
23731023 Genetic variants in HHIP are associated with FEV1 in subjects with chronic obstructive pulmonary disease.
23459001 Identification of potential HHIP targets of gene expression regulation in chronic obstructive pulmonary disease.
More...

AA Sequence

MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCG      1 - 70
GFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLL     71 - 140
CKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISR    141 - 210
KHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGD    211 - 280
ERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHR    281 - 350
KHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ    351 - 420
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGP    421 - 490
LVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELG    491 - 560
EVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWE    561 - 630
GDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV    631 - 700
//

Text Mined References (64)

PMID Year Title
26527870 2015 Candidate genes for COPD: current evidence and research.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25416442 2015 Epigenetic regulation of human hedgehog interacting protein in glioma cell lines and primary tumor samples.
25281659 2015 A novel common variant in DCST2 is associated with length in early life and height in adulthood.
25215859 2014 Shh-mediated degradation of Hhip allows cell autonomous and non-cell autonomous Shh signalling.
25101718 2015 IREB2 and GALC are associated with pulmonary artery enlargement in chronic obstructive pulmonary disease.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24439425 2014 The glypican 3 hepatocellular carcinoma marker regulates human hepatic stellate cells via Hedgehog signaling.
23994291 2013 Association of HHIP polymorphisms with COPD and COPD-related phenotypes in a Chinese Han population.
More...