Property Summary

NCBI Gene PubMed Count 70
PubMed Score 65.40
PubTator Score 62.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -1.997 6.5e-04
astrocytic glioma -1.500 2.5e-02
Astrocytoma, Pilocytic -2.500 7.2e-05
atypical teratoid / rhabdoid tumor 2.000 2.0e-02
cystic fibrosis -1.086 7.6e-05
Endometriosis 1.275 3.4e-02
ependymoma -1.600 3.7e-02
glioblastoma multiforme -2.000 1.7e-11
group 4 medulloblastoma -2.300 4.0e-03
interstitial cystitis -2.100 3.9e-04
intraductal papillary-mucinous carcinoma... -1.600 4.7e-02
lung adenocarcinoma -2.200 4.5e-08
lung carcinoma -3.800 7.4e-24
non-small cell lung cancer -2.859 5.3e-27
oligodendroglioma -1.400 3.2e-02
ovarian cancer -2.400 3.8e-12
pancreatic ductal adenocarcinoma liver m... -1.828 4.5e-03
Pick disease -1.800 2.0e-02
progressive supranuclear palsy -2.100 1.7e-02
subependymal giant cell astrocytoma -1.327 1.3e-02

 CSPA Cell Line (2)

Gene RIF (52)

AA Sequence

MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEMLCG      1 - 70
GFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQSLFHSPEREVLERDLVLPLL     71 - 140
CKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISR    141 - 210
KHKHNCFCIQEVVSGLRQPVGALHSGDGSQRLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGD    211 - 280
ERGLLSLAFHPNYKKNGKLYVSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHR    281 - 350
KHLGGQLLFGPDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ    351 - 420
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSLLEFKPFSNGP    421 - 490
LVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTSGSCRGYFSGHILGFGEDELG    491 - 560
EVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWE    561 - 630
GDFCRTAKCEPACRHGGVCVRPNKCLCKKGYLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV    631 - 700
//

Text Mined References (72)

PMID Year Title