Property Summary

NCBI Gene PubMed Count 3
PubMed Score 20.26

Knowledge Summary

Patent

No data available

AA Sequence

MGKGNEDPDLHCSSIQCSTDQPPFQQISFTEKGSDEKKPFKEKGKTAFSHSSEKHIQRQGSEPNPNKENS      1 - 70
EETKLKAGNSTAGSEPESSSYRENCRKRKMSSKDSCQDTAGNCPEKECSLSLNKKSRSSTPVHNSEIQET     71 - 140
CDAHHRGRSRACTGRSKRHRSRALGVQTPSIRKSLVTSVRAMSEAVYQDLAQVWAQQIHSPLTCEQLTLL    141 - 210
TRLRGPLCAQVQTLYSMATQAAYVFPAESWLVPATLPGPGESALDREAHPFPGQEITETVSGSDEAKL      211 - 278
//

Publication (3)

PMID Year Title
15520407 2004 FRG2, an FSHD candidate gene, is transcriptionally upregulated in differentiating primary myoblast cultures of FSHD patients.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
11829491 2002 Genomic analysis of human chromosome 10q and 4q telomeres suggests a common origin.