Property Summary

NCBI Gene PubMed Count 14
PubMed Score 385.31
PubTator Score 170.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
acute myeloid leukemia 1.400 1.6e-02
atypical teratoid / rhabdoid tumor 1.400 2.2e-03
glioblastoma 1.200 5.9e-03
group 4 medulloblastoma 1.300 7.1e-05
juvenile dermatomyositis 1.220 6.3e-12
medulloblastoma, large-cell 1.500 3.4e-05
osteosarcoma -1.533 5.7e-05
ovarian cancer 1.500 3.2e-06
primitive neuroectodermal tumor 1.100 3.2e-04

Gene RIF (1)

AA Sequence

MWEKMETKTIVYDLDTSGGLMEQIQALLAPPKTDEAEKRSRKPEKEPRRSGRATNHDSCDSCKEGGDLLC      1 - 70
CDHCPAAFHLQCCNPPLSEEMLPPGEWMCHRCTVRRKKREQKKELGHVNGLVDKSGKRTTSPSSDTDLLD     71 - 140
RSASKTELKAIAHARILERRASRPGTPTSSASTETPTSEQNDVDEDIIDVDEEPVAAEPDYVQPQLRRPF    141 - 210
ELLIAAAMERNPTQFQLPNELTCTTALPGSSKRRRKEETTGKNVKKTQHELDHNGLVPLPVKVCFTCNRS    211 - 280
CRVAPLIQCDYCPLLFHMDCLEPPLTAMPLGRWMCPNHIEHVVLNQKNMTLSNRCQVFDRFQDTVSQHVV    281 - 350
KVDFLNRIHKKHPPNRRVLQSVKRRSLKVPDAIKSQYQFPPPLIAPAAIRDGELICNGIPEESQMHLLNS    351 - 420
EHLATQAEQQEWLCSVVALQCSILKHLSAKQMPSHWDSEQTEKADIKPVIVTDSSVTTSLQTADKTPTPS    421 - 490
HYPLSCPSGISTQNSLSCSPPHQSPALEDIGCSSCAEKSKKTPCGTANGPVNTEVKANGPHLYSSPTDST    491 - 560
DPRRLPGANTPLPGLSHRQGWPRPLTPPAAGGLQNHTVGIIVKTENATGPSSCPQRSLVPVPSLPPSIPS    561 - 630
SCASIENTSTLQRKTVQSQIGPPLTDSRPLGSPPNATRVLTPPQAAGDGILATTANQRFSSPAPSSDGKV    631 - 700
SPGTLSIGSALTVPSFPANSTAMVDLTNSLRAFMDVNGEIEINMLDEKLIKFLALQRIHQLFPSRVQPSP    701 - 770
GSVGTHQLASGGHHIEVQRKEVQARAVFYPLLGLGGAVNMCYRTLYIGTGADMDVCLTNYGHCNYVSGKH    771 - 840
ACIFYDENTKHYELLNYSEHGTTVDNVLYSCDFSEKTPPTPPSSIVAKVQSVIRRRRHQKQDEEPSEEAA    841 - 910
MMSSQAQGPQRRPCNCKASSSSLIGGSGAGWEGTALLHHGSYIKLGCLQFVFSITEFATKQPKGDASLLQ    911 - 980
DGVLAEKLSLKPHQGPVLRSNSVP                                                  981 - 1004
//

Text Mined References (26)

PMID Year Title