Property Summary

NCBI Gene PubMed Count 114
Grant Count 127
R01 Count 70
Funding $20,827,892.38
PubMed Score 328.60
PubTator Score 249.19

Knowledge Summary

Patent (11,925)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.095 0.010
atypical teratoid/rhabdoid tumor 1.300 0.000
sonic hedgehog group medulloblastoma 1.100 0.001

Synonym

Accession Q96QT4 Q6ZMF5 Q86VJ4 Q8NBW2 Q9BXB2 Q9NXQ2
Symbols CHAK
CHAK1
ALSPDC
LTRPC7
LTrpC-7
TRP-PLIK

Gene

PANTHER Protein Class (2)

 GWAS Trait (1)

Gene RIF (97)

PMID Text
27020697 TRPM7 dysfunction may cause macrothrombocytopenia in humans and mice.
26780729 These results suggest that TRPM7 channel may play a critical role for zinc toxicity associated with stress.
26563869 Data show that resistant cells express lower amounts of the transient receptor potential cation channel subfamily M TRPM6 and 7, both involved in magnesium transport.
26179995 The Different Roles of The Channel-Kinases TRPM6 and TRPM7
25983327 When TRPM7 channel expression was induced from HEK293 cells in a nutrient-rich condition, LC3-II level increased indicating the increased level of basal autophagy.
25946314 TRPM7 inhibition by siRNA caused an increase in adhesion relative to control, but a decrease to 80% of calcium response relative to non-targeting siRNA which confirms the important role of TRPM7 in mechanotransduction despite the increase in adhesion.
25797249 TRPM7 expression closely associates with the migratory and metastatic properties of neuroblastoma cells in vitro and in vivo. TRPM7 controls a developmental transcriptional program involving the transcription factor SNAI2.
25472964 Data suggest that the TRPM7 channel negatively regulates the function of vascular endothelial cells.
25438992 Study demonstrates that human glioma cells express functional TRPM7 channel and that activation of this channel plays an important role in the proliferation, migration, and invasion of malignant glioma cells
25304381 High TRPM7 expression is associated with nasopharyngeal carcinoma.
More...

AA Sequence

MSQKSWIESTLTKRECVYIIPSSKDPHRCLPGCQICQQLVRCFCGRLVKQHACFTASLAMKYSDVKLGDH      1 - 70
FNQAIEEWSVEKHTEQSPTDAYGVINFQGGSHSYRAKYVRLSYDTKPEVILQLLLKEWQMELPKLVISVH     71 - 140
GGMQKFELHPRIKQLLGKGLIKAAVTTGAWILTGGVNTGVAKHVGDALKEHASRSSRKICTIGIAPWGVI    141 - 210
ENRNDLVGRDVVAPYQTLLNPLSKLNVLNNLHSHFILVDDGTVGKYGAEVRLRRELEKTINQQRIHARIG    211 - 280
QGVPVVALIFEGGPNVILTVLEYLQESPPVPVVVCEGTGRAADLLAYIHKQTEEGGNLPDAAEPDIISTI    281 - 350
KKTFNFGQNEALHLFQTLMECMKRKELITVFHIGSDEHQDIDVAILTALLKGTNASAFDQLILTLAWDRV    351 - 420
DIAKNHVFVYGQQWLVGSLEQAMLDALVMDRVAFVKLLIENGVSMHKFLTIPRLEELYNTKQGPTNPMLF    421 - 490
HLVRDVKQGNLPPGYKITLIDIGLVIEYLMGGTYRCTYTRKRFRLIYNSLGGNNRRSGRNTSSSTPQLRK    491 - 560
SHESFGNRADKKEKMRHNHFIKTAQPYRPKIDTVMEEGKKKRTKDEIVDIDDPETKRFPYPLNELLIWAC    561 - 630
LMKRQVMARFLWQHGEESMAKALVACKIYRSMAYEAKQSDLVDDTSEELKQYSNDFGQLAVELLEQSFRQ    631 - 700
DETMAMKLLTYELKNWSNSTCLKLAVSSRLRPFVAHTCTQMLLSDMWMGRLNMRKNSWYKVILSILVPPA    701 - 770
ILLLEYKTKAEMSHIPQSQDAHQMTMDDSENNFQNITEEIPMEVFKEVRILDSNEGKNEMEIQMKSKKLP    771 - 840
ITRKFYAFYHAPIVKFWFNTLAYLGFLMLYTFVVLVQMEQLPSVQEWIVIAYIFTYAIEKVREIFMSEAG    841 - 910
KVNQKIKVWFSDYFNISDTIAIISFFIGFGLRFGAKWNFANAYDNHVFVAGRLIYCLNIIFWYVRLLDFL    911 - 980
AVNQQAGPYVMMIGKMVANMFYIVVIMALVLLSFGVPRKAILYPHEAPSWTLAKDIVFHPYWMIFGEVYA    981 - 1050
YEIDVCANDSVIPQICGPGTWLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLQVKAISNIVWKYQRYHFIM   1051 - 1120
AYHEKPVLPPPLIILSHIVSLFCCICKRRKKDKTSDGPKLFLTEEDQKKLHDFEEQCVEMYFNEKDDKFH   1121 - 1190
SGSEERIRVTFERVEQMCIQIKEVGDRVNYIKRSLQSLDSQIGHLQDLSALTVDTLKTLTAQKASEASKV   1191 - 1260
HNEITRELSISKHLAQNLIDDGPVRPSVWKKHGVVNTLSSSLPQGDLESNNPFHCNILMKDDKDPQCNIF   1261 - 1330
GQDLPAVPQRKEFNFPEAGSSSGALFPSAVSPPELRQRLHGVELLKIFNKNQKLGSSSTSIPHLSSPPTK   1331 - 1400
FFVSTPSQPSCKSHLETGTKDQETVCSKATEGDNTEFGAFVGHRDSMDLQRFKETSNKIKILSNNNTSEN   1401 - 1470
TLKRVSSLAGFTDCHRTSIPVHSKQAEKISRRPSTEDTHEVDSKAALIPDWLQDRPSNREMPSEEGTLNG   1471 - 1540
LTSPFKPAMDTNYYYSAVERNNLMRLSQSIPFTPVPPRGEPVTVYRLEESSPNILNNSMSSWSQLGLCAK   1541 - 1610
IEFLSKEEMGGGLRRAVKVQCTWSEHDILKSGHLYIIKSFLPEVVNTWSSIYKEDTVLHLCLREIQQQRA   1611 - 1680
AQKLTFAFNQMKPKSIPYSPRFLEVFLLYCHSAGQWFAVEECMTGEFRKYNNNNGDEIIPTNTLEEIMLA   1681 - 1750
FSHWTYEYTRGELLVLDLQGVGENLTDPSVIKAEEKRSCDMVFGPANLGEDAIKNFRAKHHCNSCCRKLK   1751 - 1820
LPDLKRNDYTPDKIIFPQDEPSDLNLQPGNSTKESESTNSVRLML                            1821 - 1865
//

Publication (119)

PMID Year Title
27020697 2016 Defects in TRPM7 channel function deregulate thrombopoiesis through altered cellular Mg(2+) homeostasis and cytoskeletal architecture.
26780729 2016 Stress hormone potentiates Zn(2+)-induced neurotoxicity via TRPM7 channel in dopaminergic neuron.
26563869 2015 Magnesium homeostasis in colon carcinoma LoVo cells sensitive or resistant to doxorubicin.
26179995 2015 The Different Roles of The Channel-Kinases TRPM6 and TRPM7.
25983327 2015 Regulation of basal autophagy by transient receptor potential melastatin 7 (TRPM7) channel.
25946314 2015 Rapid and Localized Mechanical Stimulation and Adhesion Assay: TRPM7 Involvement in Calcium Signaling and Cell Adhesion.
25797249 2015 TRPM7 maintains progenitor-like features of neuroblastoma cells: implications for metastasis formation.
25472964 2015 TRPM7 regulates vascular endothelial cell adhesion and tube formation.
25438992 2015 Suppression of TRPM7 inhibits proliferation, migration, and invasion of malignant human glioma cells.
25304381 2015 TRPM7 promotes the metastatic process in human nasopharyngeal carcinoma.
More...