Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (418)

Gene RIF (1)

PMID Text
12471243 First description of PSKH2, predicted as a catalytically-active protein kinase homolog of PSKH1.

AA Sequence

MGCGASRKVVPGPPALAWAKHEGQNQAGVGGAGPGPEAAAQAAQRIQVARFRAKFDPRVLARYDIKALIG      1 - 70
TGSFSRVVRVEQKTTKKPFAIKVMETREREGREACVSELSVLRRVSHRYIVQLMEIFETEDQVYMVMELA     71 - 140
TGGELFDRLIAQGSFTERDAVRILQMVADGIRYLHALQITHRNLKPENLLYYHPGEESKILITDFGLAYS    141 - 210
GKKSGDWTMKTLCGTPEYIAPEVLLRKPYTSAVDMWALGVITYALLSGFLPFDDESQTRLYRKILKGKYN    211 - 280
YTGEPWPSISHLAKDFIDKLLILEAGHRMSAGQALDHPWVITMAAGSSMKNLQRAISRNLMQRASPHSQS    281 - 350
PGSAQSSKSHYSHKSRHMWSKRNLRIVESPLSALL                                       351 - 385
//

Publication (4)

PMID Year Title
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471243 2002 The protein kinase complement of the human genome.