Property Summary

NCBI Gene PubMed Count 78
PubMed Score 163.67
PubTator Score 289.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -3.000 1.5e-03
Astrocytoma, Pilocytic -2.600 2.8e-03
atypical teratoid / rhabdoid tumor -1.900 3.3e-02
chronic rhinosinusitis -1.349 1.6e-02
cystic fibrosis and chronic rhinosinusit... -1.486 2.8e-02
ependymoma -3.700 4.9e-04
glioblastoma -3.000 6.3e-03
group 3 medulloblastoma -3.800 2.5e-02
medulloblastoma, large-cell -4.100 4.8e-03
oligodendroglioma -2.600 6.5e-03
ovarian cancer -5.000 2.8e-17
pituitary cancer -1.900 6.8e-05

Gene RIF (65)

AA Sequence

MSNQYQEEGCSERPECKSKSPTLLSSYCIDSILGRRSPCKMRLLGAAQSLPAPLTSRADPEKAVQGSPKS      1 - 70
SSAPFEAELHLPPKLRRLYGPGGGRLLQGAAAAAAAAAAAAAAAATATAGPRGEAPPPPPPTARPGERPD     71 - 140
GAGAAAAAAAAAAAAWDTLKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGG    141 - 210
PGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPRRCPVAATGAVAAAAAA    211 - 280
AVATEGGELSPKEELLLHPEDAEGKDGEDSVCLSAGSDSEEGLLKRKQRRYRTTFTSYQLEELERAFQKT    281 - 350
HYPDVFTREELAMRLDLTEARVQVWFQNRRAKWRKREKAGAQTHPPGLPFPGPLSATHPLSPYLDASPFP    351 - 420
PHHPALDSAWTAAAAAAAAAFPSLPPPPGSASLPPSGAPLGLSTFLGAAVFRHPAFISPAFGRLFSTMAP    421 - 490
LTSASTAAALLRQPTPAVEGAVASGALADPATAAADRRASSIAALRLKAKEHAAQLTQLNILPGTSTGKE    491 - 560
VC                                                                        561 - 562
//

Text Mined References (79)

PMID Year Title