Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.31
PubTator Score 4.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.083 1.7e-05
psoriasis 2.100 1.5e-04
tuberculosis 2.100 2.0e-08

Synonym

Accession Q96QS1 Q96KX4 Q9HC50 Q9HC51 Q9Y5U1 Tspan-32
Symbols ART1
PHMX
PHEMX
TSSC6

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (1)

AA Sequence

MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQWAFSAGLSLVG      1 - 70
LLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVEDAMLDTYDLVYEQAMKGTSH     71 - 140
VRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAREDCLQGIRSFLRTHQQVASSLTSIGLALTV    141 - 210
SALLFSSFLWFAIRCGCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLR    211 - 280
WLQESDAAPLPLSCHLAAHRALQGRSRGGLSGCPERGLSD                                  281 - 320
//

Text Mined References (13)

PMID Year Title