Property Summary

NCBI Gene PubMed Count 13
Grant Count 11
R01 Count 10
Funding $257,153.6
PubMed Score 7.73
PubTator Score 4.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 2.100 0.000
osteosarcoma -2.171 0.000
tuberculosis 2.100 0.000

Gene RIF (1)

PMID Text
20709950 In the absence of both CD37 and Tssc6, immune function is further altered when compared with CD37- or Tssc6-deficient transgenic mice, demonstrating a complementary role for these two molecules in cellular immunity.

AA Sequence

MGPWSRVRVAKCQMLVTCFFILLLGLSVATMVTLTYFGAHFAVIRRASLEKNPYQAVHQWAFSAGLSLVG      1 - 70
LLTLGAVLSAAATVREAQGLMAGGFLCFSLAFCAQVQVVFWRLHSPTQVEDAMLDTYDLVYEQAMKGTSH     71 - 140
VRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAREDCLQGIRSFLRTHQQVASSLTSIGLALTV    141 - 210
SALLFSSFLWFAIRCGCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLR    211 - 280
WLQESDAAPLPLSCHLAAHRALQGRSRGGLSGCPERGLSD                                  281 - 320
//

Publication (13)

PMID Year Title
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
20709950 2010 A complementary role for the tetraspanins CD37 and Tssc6 in cellular immunity.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14759258 2004 An unappreciated role for RNA surveillance.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11718897 2001 Molecular characterisation of mouse and human TSSC6: evidence that TSSC6 is a genuine member of the tetraspanin superfamily and is expressed specifically in haematopoietic organs.
10950922 2000 Phemx, a novel mouse gene expressed in hematopoietic cells maps to the imprinted cluster on distal chromosome 7.
10915772 2000 Sequence conservation and variability of imprinting in the Beckwith-Wiedemann syndrome gene cluster in human and mouse.
More...