Property Summary

NCBI Gene PubMed Count 39
Grant Count 21
R01 Count 10
Funding $2,879,190.2
PubMed Score 28.57
PubTator Score 34.45

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26370119 Tumor-adjacent tissues showed higher methylation status of RASSF1A, HIN-1 and MGMT promoters.
24850174 aberrant HIN-1 promoter methylation could be an independent and important biomarker used in predicting the prognosis and progression of breast cancer
24710847 SCGB3A1-183 T and SCGB3A1 IVS1-189 A alleles might have a protective effect against nasal polyposis.
22871047 Methylation of HIN-1 promoter is a novel epigenetic biomarker associated with poor outcomes in OCCA patients.
22695491 Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancers was associated with clinical characteristics, but only RASSF1A methylation was associated with time to first recurrence and overall survival.
22095135 analysis of AKT signaling pathway activated by HIN-1 methylation in non-small cell lung cancer
22048254 HIN1, was the most "dietary sensitive" genes, as methylation of their promoters was associated with intakes of at least two out of the eight dietary methyl factors examined.
21812955 Data show that SCGB3A1 was down-regulated in invasive compared with DCIS, whereas talin 2 (TLN2) and PTGS1 were up-regulated in invasive compared with DCIS.
21274384 Data suggest that high methylation of the HIN-1 promoter results in silenced HIN-1 expression in gastric cancer, and that 5-aza-2'-deoxycytidine reverses HIN-1 methylation and reduces viability of gastric cancer cells.
20642860 Hypermethylation of HIN-1 is associated with lymphatic metastasis of breast cancers.
More...

AA Sequence

MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNH      1 - 70
LIEGSQKCVAELGPQAVGAVKALKALLGALTVFG                                         71 - 104
//

Publication (40)

PMID Year Title
26370119 2015 Applicability of HIN-1, MGMT and RASSF1A promoter methylation as biomarkers for detecting field cancerization in breast cancer.
24850174 2014 Aberrant promoter methylation of HIN-1 gene may contribute to the pathogenesis of breast cancer: a meta-analysis.
24710847 2014 Investigation of SCGB3A1 (UGRP2) gene arrays in patients with nasal polyposis.
22871047 2012 Promoter methylation status of HIN-1 associated with outcomes of ovarian clear cell adenocarcinoma.
22695491 2012 Methylation of HIN-1, RASSF1A, RIL and CDH13 in breast cancer is associated with clinical characteristics, but only RASSF1A methylation is associated with outcome.
22155607 2011 Update of the human secretoglobin (SCGB) gene superfamily and an example of 'evolutionary bloom' of androgen-binding protein genes within the mouse Scgb gene superfamily.
22095135 2012 AKT signaling pathway activated by HIN-1 methylation in non-small cell lung cancer.
22048254 2011 The influence of one-carbon metabolism on gene promoter methylation in a population-based breast cancer study.
21812955 2011 Serum estradiol levels associated with specific gene expression patterns in normal breast tissue and in breast carcinomas.
21274384 2011 Silence of HIN-1 expression through methylation of its gene promoter in gastric cancer.
More...