Property Summary

NCBI Gene PubMed Count 40
PubMed Score 30.82
PubTator Score 34.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -2.100 1.7e-05
breast carcinoma -2.000 8.1e-12
cystic fibrosis -2.700 1.4e-06
intraductal papillary-mucinous adenoma (... -2.200 3.1e-03
intraductal papillary-mucinous carcinoma... -1.900 3.8e-02
intraductal papillary-mucinous neoplasm ... -2.400 3.1e-03
invasive ductal carcinoma -1.725 1.9e-02
lung carcinoma -1.400 1.3e-05
non-small cell lung cancer -3.201 1.8e-11
pituitary cancer -1.100 1.9e-02
primary pancreatic ductal adenocarcinoma -1.155 9.4e-03
psoriasis -2.600 2.1e-21

Gene RIF (28)

AA Sequence

MKLAALLGLCVALSCSSAAAFLVGSAKPVAQPVAALESAAEAGAGTLANPLGTLNPLKLLLSSLGIPVNH      1 - 70
LIEGSQKCVAELGPQAVGAVKALKALLGALTVFG                                         71 - 104
//

Text Mined References (41)

PMID Year Title