Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.72
PubTator Score 0.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Atopic dermatitis -1.600 0.000
interstitial cystitis -2.200 0.000
psoriasis -2.700 0.000
nasopharyngeal carcinoma -1.600 0.000
spina bifida -1.508 0.017

Synonym

Accession Q96QI5 Q96RX7
Symbols HS3ST5
3-OST-6

Gene

Gene RIF (1)

PMID Text
12138164 generates both an antithrombin-binding site and an entry receptor for herpes simplex virus, type 1

AA Sequence

MAGSGGLGGGAGGGQGAGAGQGAALRASRAPMLLVALVLGAYCLCALPGRCPPAARAPAPAPAPSEPSSS      1 - 70
VHRPGAPGLPLASGPGRRRFPQALIVGVKKGGTRALLEFLRLHPDVRALGSEPHFFDRCYERGLAWYRSL     71 - 140
MPRTLDGQITMEKTPSYFVTREAPRRIHAMSPDTKLIVVVRNPVTRAISDYAQTLSKTPGLPSFRALAFR    141 - 210
HGLGPVDTAWSAVRIGLYAQHLDHWLRYFPLSHFLFVSGERLVSDPAGEVGRVQDFLGLKRVVTDKHFYF    211 - 280
NATKGFPCLKKAQGGSRPRCLGKSKGRPHPRVPQALVRRLQEFYRPFNRRFYQMTGQDFGWG            281 - 342
//

Text Mined References (6)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15303968 2005 Characterization of heparan sulphate 3-O-sulphotransferase isoform 6 and its role in assisting the entry of herpes simplex virus type 1.
12907690 2003 Biosynthesis of 3-O-sulfated heparan sulfate: unique substrate specificity of heparan sulfate 3-O-sulfotransferase isoform 5.
12740361 2003 Characterization of a heparan sulfate 3-O-sulfotransferase-5, an enzyme synthesizing a tetrasulfated disaccharide.
12138164 2002 Heparan sulfate 3-O-sulfotransferase isoform 5 generates both an antithrombin-binding site and an entry receptor for herpes simplex virus, type 1.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.