Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Transitional cell carcinoma 18 3.049 1.5

Expression

AA Sequence

MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDG      1 - 70
SSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHCSGHDL     71 - 140
SEWLKGCDMHVKIDPKIHP                                                       141 - 159
//

Publication (3)

PMID Year Title
16382448 2006 Identification of a new cancer/testis gene family, CT47, among expressed multicopy genes on the human X chromosome.
15772651 2005 The DNA sequence of the human X chromosome.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.