Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
transitional cell carcinoma 22 3.096 1.5

Expression

AA Sequence

MKAWGTVVVTLATLMVVTVDAKIYERCELAARLERAGLNGYKGYGVGDWLCMAHYESGFDTAFVDHNPDG      1 - 70
SSEYGIFQLNSAWWCDNGITPTKNLCHMDCHDLLNRHILDDIRCAKQIVSSQNGLSAWTSWRLHCSGHDL     71 - 140
SEWLKGCDMHVKIDPKIHP                                                       141 - 159
//

Text Mined References (3)

PMID Year Title