Property Summary

NCBI Gene PubMed Count 21
PubMed Score 152.07
PubTator Score 26.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid/rhabdoid tumor -1.100 1.1e-03
group 4 medulloblastoma -1.700 2.9e-04
medulloblastoma, large-cell -1.900 1.9e-06
non-small cell lung cancer -1.343 8.7e-22
osteosarcoma -4.171 5.3e-07
tuberculosis 2.500 4.4e-09

Gene RIF (11)

AA Sequence

MAHHLPAAMESHQDFRSIKAKFQASQPEPSDLPKKPPKPEFGKLKKFSQPELSEHPKKAPLPEFGAVSLK      1 - 70
PPQPQFTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLP     71 - 140
KKPPPPEVTDLPKKPPPPEVTDLPKKPSKLELSDLSKKFPQLGATPFPRKPLQPEVGEAPLKASLPEPGA    141 - 210
PARKPLQPDELSHPARPPSEPKSGAFPRKLWQPEAGEATPRSPQPELSTFPKKPAQPEFNVYPKKPPQPQ    211 - 280
VGGLPKKSVPQPEFSEAAQTPLWKPQSSEPKRDSSAFPKKASQPPLSDFPKKPPQPELGDLTRTSSEPEV    281 - 350
SVLPKRPRPAEFKALSKKPPQPELGGLPRTSSEPEFNSLPRKLLQPERRGPPRKFSQPEPSAVLKRHPQP    351 - 420
EFFGDLPRKPPLPSSASESSLPAAVAGFSSRHPLSPGFGAAGTPRWRSGGLVHSGGARPGLRPSHPPRRR    421 - 490
PLPPASSLGHPPAKPPLPPGPVDMQSFRRPSAASIDLRRTRSAAGLHFQDRQPEDIPQVPDEIYELYDDV    491 - 560
EPRDDSSPSPKGRDEAPSVQQAARRPPQDPALRKEKDPQPQQLPPMDPKLLKQLRKAEKAEREFRKKFKF    561 - 630
EGEIVVHTKMMIDPNAKTRRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVPRTALLPLETEVY    631 - 700
DDVDFCDPLENQPLPLGR                                                        701 - 718
//

Text Mined References (24)

PMID Year Title