Property Summary

NCBI Gene PubMed Count 20
Grant Count 60
R01 Count 38
Funding $5,443,140.89
PubMed Score 151.36
PubTator Score 26.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -4.171 0.000
group 4 medulloblastoma -1.700 0.000
medulloblastoma, large-cell -1.900 0.000
tuberculosis 2.500 0.000
non-small cell lung cancer -1.343 0.000
atypical teratoid/rhabdoid tumor -1.100 0.001

Gene RIF (11)

PMID Text
25944686 Our results show that the pretreatment PML-RARA molecular burden could therefore be used to improve risk stratification in order to develop more individualized treatment regimens for high-risk APL cases.
25815789 The 3-plex RT-qPCR assay is a specific, sensitive, stable, and cost-effective method that can be used for the rapid diagnosis and treatment monitoring of acute promyelocytic leukemia with PML-RARa
25126724 The MIR125B1-mediated blockade of PML-RARA proteolysis was regulated via an autophagy-lysosomal pathway, contributing to the inhibition of acute promyelocytic leukemia differentiation.
21673516 autophagy contributes to the anti-apoptotic function of the PML-RARalpha protein through inhibiting the Akt/mTOR pathway
19623654 We conclude that our sp-RQ-PCR is specific enough to identify various forms of PML-RARalpha and yields no false-positive results.
19109227 hidden abnormalities and novel disease-related genomic changes occur in t(15;17)translocation in acute promyelocytic leukemia formation of PML-RARA gene
16831444 Interaction of PRAM-1 and hSH3 domains of adhesion and degranulation promoting adapter protein (ADAP) with phosphatidylcholine-containing liposomes is observed upon incorporation of phosphatidylserine or phosphoinositides into the membrane bilayer.
16502582 PML-RARalpha fusion transcripts have been shown to be useful markers for establishing the diagnosis and for monitoring the response to treatment of acute promyelocytic leukemia.
16502581 The use of reverse-transcription polymerase chain reaction for the detection of the PML-RARA and RARA-PML fusion genes that allow for monitoring of acute myelocytic leukemia.
15637062 Caspase 3-cleaved SH3 domain of HIP-55 is likely involved in PRAM-1-mediated JNK activation upon arsenic trioxide-induced differentiation of NB4 cells.
More...

AA Sequence

MAHHLPAAMESHQDFRSIKAKFQASQPEPSDLPKKPPKPEFGKLKKFSQPELSEHPKKAPLPEFGAVSLK      1 - 70
PPQPQFTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLPKKPPPPEVTDLP     71 - 140
KKPPPPEVTDLPKKPPPPEVTDLPKKPSKLELSDLSKKFPQLGATPFPRKPLQPEVGEAPLKASLPEPGA    141 - 210
PARKPLQPDELSHPARPPSEPKSGAFPRKLWQPEAGEATPRSPQPELSTFPKKPAQPEFNVYPKKPPQPQ    211 - 280
VGGLPKKSVPQPEFSEAAQTPLWKPQSSEPKRDSSAFPKKASQPPLSDFPKKPPQPELGDLTRTSSEPEV    281 - 350
SVLPKRPRPAEFKALSKKPPQPELGGLPRTSSEPEFNSLPRKLLQPERRGPPRKFSQPEPSAVLKRHPQP    351 - 420
EFFGDLPRKPPLPSSASESSLPAAVAGFSSRHPLSPGFGAAGTPRWRSGGLVHSGGARPGLRPSHPPRRR    421 - 490
PLPPASSLGHPPAKPPLPPGPVDMQSFRRPSAASIDLRRTRSAAGLHFQDRQPEDIPQVPDEIYELYDDV    491 - 560
EPRDDSSPSPKGRDEAPSVQQAARRPPQDPALRKEKDPQPQQLPPMDPKLLKQLRKAEKAEREFRKKFKF    561 - 630
EGEIVVHTKMMIDPNAKTRRGGGKHLGIRRGEILEVIEFTSNEEMLCRDPKGKYGYVPRTALLPLETEVY    631 - 700
DDVDFCDPLENQPLPLGR                                                        701 - 718
//

Publication (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25944686 2015 Absolute quantification of the pretreatment PML-RARA transcript defines the relapse risk in acute promyelocytic leukemia.
25815789 2015 Development and validation of a 3-Plex RT-qPCR assay for the simultaneous detection and quantitation of the three PML-RARa fusion transcripts in acute promyelocytic leukemia.
25416956 2014 A proteome-scale map of the human interactome network.
25126724 2014 MIR125B1 represses the degradation of the PML-RARA oncoprotein by an autophagy-lysosomal pathway in acute promyelocytic leukemia.
21673516 2011 PML-RAR? enhances constitutive autophagic activity through inhibiting the Akt/mTOR pathway.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
20873783 2010 Characterization of hNek6 interactome reveals an important role for its short N-terminal domain and colocalization with proteins at the centrosome.
19623654 2009 Quantitative detection of PML-RARalpha fusion transcript by real-time PCR with a single primer pair.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...