Property Summary

NCBI Gene PubMed Count 25
Grant Count 10
R01 Count 8
Funding $1,111,107.92
PubMed Score 10.62
PubTator Score 10.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (5)

PMID Text
26258637 Authors show that Rab11-GMPPNP-FIP3-Rabin8 is more stable than Rab11-GMPPNP-Rabin8, owing to direct interaction between Rabin8 and FIP3 within the dual effector-bound complex.
25787272 the role of Rabin8 (a mammalian ortholog of Sec2p) with Rab8-nucleotide-exchange factor activity in autophagy in mammalian cells, was examined.
25673879 Rab11-FIP3 coordinates the interactions of ASAP1 and Rab11a with Rabin8.
25535387 Rabin8 was identified as a direct phospho-substrate of ERK1/2 in response to EGF signaling.
12007189 RABIN3 interacts with the cancer-related protein SSX2 and a novel nuclear protein, SSX2IP.

AA Sequence

MGLKKMKGLSYDEAFAMANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQ      1 - 70
ANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATI     71 - 140
TEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELE    141 - 210
ELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFK    211 - 280
KGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLT    281 - 350
FSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYIS    351 - 420
PFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL                  421 - 476
//

Publication (34)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26824392 2016 Phosphoproteomics reveals that Parkinson's disease kinase LRRK2 regulates a subset of Rab GTPases.
26258637 2015 Structure of Rab11-FIP3-Rabin8 reveals simultaneous binding of FIP3 and Rabin8 effectors to Rab11.
25787272 2015 Rabin8 suppresses autophagosome formation independently of its guanine nucleotide-exchange activity towards Rab8.
25673879 2015 The Arf and Rab11 effector FIP3 acts synergistically with ASAP1 to direct Rabin8 in ciliary receptor targeting.
25535387 2015 Activation of Rab8 guanine nucleotide exchange factor Rabin8 by ERK1/2 in response to EGF signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23382462 2013 RabGEFs are a major determinant for specific Rab membrane targeting.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...