Property Summary

NCBI Gene PubMed Count 25
PubMed Score 11.58
PubTator Score 10.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
active Crohn's disease -1.037 2.2e-02
active ulcerative colitis -1.227 1.2e-02
Astrocytoma, Pilocytic 2.100 5.8e-07
atypical teratoid / rhabdoid tumor -1.600 3.3e-04
Breast cancer 2.700 3.1e-02
breast carcinoma 1.200 2.4e-03
ductal carcinoma in situ 1.500 2.2e-02
ependymoma -1.100 3.1e-04
gastric cancer 1.400 7.2e-03
intraductal papillary-mucinous neoplasm ... 1.200 4.8e-02
invasive ductal carcinoma 1.100 7.3e-03
lung carcinoma 1.500 5.0e-22
medulloblastoma, large-cell -1.800 1.8e-03
oligodendroglioma 1.700 2.3e-02
osteosarcoma -1.264 6.1e-03
ovarian cancer -1.600 3.5e-07
pituitary cancer 1.200 5.2e-03
sonic hedgehog group medulloblastoma -1.200 9.7e-04

Gene RIF (5)

AA Sequence

MGLKKMKGLSYDEAFAMANDPLEGFHEVNLASPTSPDLLGVYESGTQEQTTSPSVIYRPHPSALSSVPIQ      1 - 70
ANALDVSELPTQPVYSSPRRLNCAEISSISFHVTDPAPCSTSGVTAGLTKLTTRKDNYNAEREFLQGATI     71 - 140
TEACDGSDDIFGLSTDSLSRLRSPSVLEVREKGYERLKEELAKAQRELKLKDEECERLSKVRDQLGQELE    141 - 210
ELTASLFEEAHKMVREANIKQATAEKQLKEAQGKIDVLQAEVAALKTLVLSSSPTSPTQEPLPGGKTPFK    211 - 280
KGHTRNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLT    281 - 350
FSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYIS    351 - 420
PFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL                  421 - 476
//

Text Mined References (34)

PMID Year Title