Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.91
PubTator Score 2.37

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96QE5 E1P655 Q6GPG5 Q6PJ19 Q96H04 Q9H5Z9
Symbols C17orf42

Gene

Gene RIF (4)

PMID Text
25690892 Data indicate transcription elongation factor (TEFM) as an essential component of the mitochondrial transcription machinery.
25635099 study found interaction of TEFM with mitochondrial RNA polymerase and nascent transcript prevents generation of replication primers and increases transcription processivity and serves as a molecular switch between replication and transcription, which appear to be mutually exclusive processes in mitochondria
21278163 The TEFM protein is proposed to be a critical component of the transcription apparatus of human mitochondria.
19291764 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGSVLFTAGERWRCFLTPSRSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ      1 - 70
ASILHVLNTASTKELEAFRLLRGRRSINIVEHRENFGPFQNLESLMNVPLFKYKSTVQVCNSILCPKTGR     71 - 140
EKRKSPENRFLRKLLKPDIERERLKAVNSIISIVFGTRRIAWAHLDRKLTVLDWQQSDRWSLMRGIYSSS    141 - 210
VYLEEISSIISKMPKADFYVLEKTGLSIQNSSLFPILLHFHIMEAMLYALLNKTFAQDGQHQVLSMNRNA    211 - 280
VGKHFELMIGDSRTSGKELVKQFLFDSILKADPRVFFPSDKIVHYRQMFLSTELQRVEELYDSLLQAIAF    281 - 350
YELAVFDSQP                                                                351 - 360
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25690892 2015 TEFM is a potent stimulator of mitochondrial transcription elongation in vitro.
25635099 2015 Mitochondrial biology. Replication-transcription switch in human mitochondria.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21278163 2011 TEFM (c17orf42) is necessary for transcription of human mtDNA.
21269460 2011 Initial characterization of the human central proteome.
19291764 2009 RNF135 mutations are not present in patients with Sotos syndrome-like features.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...