Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.91
PubTator Score 2.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (5)

AA Sequence

MSGSVLFTAGERWRCFLTPSRSSLYWALHNFCCRKKSTTPKKITPNVTFCDENAKEPENALDKLFSSEQQ      1 - 70
ASILHVLNTASTKELEAFRLLRGRRSINIVEHRENFGPFQNLESLMNVPLFKYKSTVQVCNSILCPKTGR     71 - 140
EKRKSPENRFLRKLLKPDIERERLKAVNSIISIVFGTRRIAWAHLDRKLTVLDWQQSDRWSLMRGIYSSS    141 - 210
VYLEEISSIISKMPKADFYVLEKTGLSIQNSSLFPILLHFHIMEAMLYALLNKTFAQDGQHQVLSMNRNA    211 - 280
VGKHFELMIGDSRTSGKELVKQFLFDSILKADPRVFFPSDKIVHYRQMFLSTELQRVEELYDSLLQAIAF    281 - 350
YELAVFDSQP                                                                351 - 360
//

Text Mined References (17)

PMID Year Title