Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.03
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Neurofibromatosis 37 3.64 1.8
Neurofibroma 9 3.066 1.5

Expression

Gene RIF (1)

PMID Text
19291764 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSWLRFWGPWPLLTWQLLSLLVKEAQPLVWVKDPLQLTSNPLGPPEPWSSRSSHLPWESPHAPAPPAAPG      1 - 70
DFDYLGPSASSQMSALPQEPTENLAPFLKELDSAGELPLGPEPFLAAHQDLNDKRTPEERLPEVVPLLNR     71 - 140
DQNQALVQLPRLKWVQTTDLDRAAGHQADEILVPLDSKVSRPTKFVVSPKNLKKDLAERWSLPEIVGIPH    141 - 210
QLSKPQRQKQTLPDDYLSMDTLYPGSLPPELRVNADEPPGPPEQVGLSQFHLEPKSQNPETLEDIQSSSL    211 - 280
QEEAPAQLLQLPQEVEPSTQQEAPALPPESSMESLAQTPLNHEVTVQPPGEDQAHYNLPKFTVKPADVEV    281 - 350
TMTSEPKNETESTQAQQEAPIQPPEEAEPSSTALRTTDPPPEHPEVTLPPSDKGQAQHSHLTEATVQPLD    351 - 420
LELSITTEPTTEVKPSPTTEETSAQPPDPGLAITPEPTTEIGHSTALEKTRAPHPDQVQTLHRSLTEVTG    421 - 490
PPTKLESSQDSLVQSETAPEEQKASTSTNICELCTCGDETLSCVGLSPKQRLRQVPVPEPDTYNGIFTTL    491 - 560
NFQGNYISYLDGNVWKAYSWTEKLILSENYLTELPKDSFEGLLYLQYLDLSCNKIRYIERQTFESLPFLQ    561 - 630
YINLGCNLITKLSLGTFQAWHGMQFLHNLILNRNPLTTVEDPYLFELPALKYLDMGTTHITLTTLKNILT    631 - 700
MTVELEKLILPSHMACCLCQFKNSIEAVCKTVKLHCNTACLTNSIHCPEEASVGNPEGAFMKMLQARKQH    701 - 770
MSTQLTIESEAPSDSSGINLSGFGGDQLEIQLTEQLRSLIPNEDVRKFMSHVIRTLKMECSETHVQGSCA    771 - 840
KLMLRTGLLMKLLSEQQEAKALNVEWDTDQQKTNYINENMEQNEQKEQKSSELMKEVPGDDYKNKLIFAI    841 - 910
SVTVILIILIIIFCLIEVNSHKRASEKYKDNPSISGA                                     911 - 947
//

Publication (12)

PMID Year Title
23064749 2013 Evolutionary dynamism of the primate LRRC37 gene family.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
19291764 2009 RNF135 mutations are not present in patients with Sotos syndrome-like features.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17632510 2007 Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15236313 2004 Genomic context of paralogous recombination hotspots mediating recurrent NF1 region microdeletion.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11468690 2001 Molecular characterization and gene content of breakpoint boundaries in patients with neurofibromatosis type 1 with 17q11.2 microdeletions.
More...