Property Summary

NCBI Gene PubMed Count 18
Grant Count 21
R01 Count 2
Funding $3,594,896.29
PubMed Score 41.44
PubTator Score 19.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

MLP Assay (17)

AID Type Active / Inconclusive / Inactive Description
493106 confirmatory 35 / 74 / 1171 Validation screen for small molecules that induce genotoxicity in human embryonic kidney (HEK293T) cells expressing luciferase-tagged ELG1
493107 confirmatory 79 / 294 / 907 Validation screen for small molecules that inhibit ELG1-dependent DNA repair in human embryonic kidney (HEK293T) cells expressing luciferase-tagged ELG1
493125 summary 0 / 0 / 0 qHTS assay for small molecules that inhibit ELG1-dependent DNA repair in human embryonic kidney (HEK293T) cells expressing luciferase-tagged ELG1: Summary
493143 summary 0 / 0 / 0 qHTS assay for small molecules that induce genotoxicity in human embryonic kidney (HEK293T) cells expressing luciferase-tagged ELG1: Summary
504466 confirmatory 4174 / 19124 / 306924 qHTS screen for small molecules that induce genotoxicity in human embryonic kidney (HEK293T) cells expressing luciferase-tagged ELG1
504467 confirmatory 7656 / 86900 / 235723 qHTS screen for small molecules that inhibit ELG1-dependent DNA repair in human embryonic kidney (HEK293T) cells expressing luciferase-tagged ELG1
624247 confirmatory 10 / 59 / 279 qHTS screen for small molecules that inhibit ELG1-dependent DNA repair: Hit Confirmation in Cell-Based Luciferin Assay
624248 confirmatory 458 / 154 / 58 HTS assay for small molecules that inhibit ELG1-dependent DNA repair in human embryonic kidney (HEK293T) cells expressing luciferase-tagged ELG1: Hit Confirmation
624249 confirmatory 355 / 142 / 173 qHTS screen for small molecules that inhibit ELG1-dependent DNA repair in human embryonic kidney (HEK293T) cells expressing luciferase-tagged ELG1: Hit Confirmation using MMS Stimulated ELG1
624250 confirmatory 8 / 316 / 346 qHTS screen for small molecules that inhibit ELG1-dependent DNA repair: Hit Confirmation with 5FU Viability
More...

Gene RIF (10)

PMID Text
25795125 Authors discuss many functions of Elg1 protein as embryonic lethal when lost in mice, as a tumor suppressor in mice and humans, interacts with human Fanconi Anemia pathway and may contribute to some of the phenotypes associated with neurofibromatosis. [Review]
23937667 Elg1 has an important role in maintaining chromosome integrity by regulating PCNA levels on chromatin, thereby acting as a PCNA unloading factor.
23277426 ATAD5 regulates the cycle of DNA replication factories, probably through its PCNA-unloading activity.
21901109 loss-of-function mutations in mammalian Atad5 are sufficient to cause genomic instability and tumorigenesis.
21640107 Studies indicate that USP1 and ELG1 as regulators of PCNA ubiquitylation.
20546612 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19755857 Human ELG1 protein is stabilized and localized to form foci at sites of stalled DNA replications that are different from DNA double strand breaks foci.
19291764 Observational study of gene-disease association. (HuGE Navigator)
15983387 The Frag1 signal pathway, by linking replication stress surveillance with apoptosis induction, plays a central role in determining whether DNA damage is compatible with cell survival or whether it requires cell elimination by apoptosis.

AA Sequence

MVGVLAMAAAAAPPPVKDCEIEPCKKRKKDDDTSTCKTITKYLSPLGKTRDRVFAPPKPSNILDYFRKTS      1 - 70
PTNEKTQLGKECKIKSPESVPVDSNKDCTTPLEMFSNVEFKKKRKRVNLSHQLNNIKTENEAPIEISSDD     71 - 140
SKEDYSLNNDFVESSTSVLRYKKQVEVLAENIQDTKSQPNTMTSLQNSKKVNPKQGTTKNDFKKLRKRKC    141 - 210
RDVVDLSESLPLAEELNLLKKDGKDTKQMENTTSHANSRDNVTEAAQLNDSIITVSYEEFLKSHKENKVE    211 - 280
EIPDSTMSICVPSETVDEIVKSGYISESENSEISQQVRFKTVTVLAQVHPIPPKKTGKIPRIFLKQKQFE    281 - 350
MENSLSDPENEQTVQKRKSNVVIQEEELELAVLEAGSSEAVKPKCTLEERQQFMKAFRQPASDALKNGVK    351 - 420
KSSDKQKDLNEKCLYEVGRDDNSKKIMENSGIQMVSKNGNLQLHTDKGSFLKEKNKKLKKKNKKTLDTGA    421 - 490
IPGKNREGNTQKKETTFFLKEKQYQNRMSLRQRKTEFFKSSTLFNNESLVYEDIANDDLLKVSSLCNNNK    491 - 560
LSRKTSIPVKDIKLTQSKAESEASLLNVSTPKSTRRSGRISSTPTTETIRGIDSDDVQDNSQLKASTQKA    561 - 630
ANLSEKHSLYTAELITVPFDSESPIRMKFTRISTPKKSKKKSNKRSEKSEATDGGFTSQIRKASNTSKNI    631 - 700
SKAKQLIEKAKALHISRSKVTEEIAIPLRRSSRHQTLPERKKLSETEDSVIIIDSSPTALKHPEKNQKKL    701 - 770
QCLNDVLGKKLNTSTKNVPGKMKVAPLFLVRKAQKAADPVPSFDESSQDTSEKSQDCDVQCKAKRDFLMS    771 - 840
GLPDLLKRQIAKKAAALDVYNAVSTSFQRVVHVQQKDDGCCLWHLKPPSCPLLTKFKELNTKVIDLSKCG    841 - 910
IALGEFSTLNSKLKSGNSAAVFMRTRKEFTEEVRNLLLEEIRWSNPEFSLKKYFPLLLKKQIEHQVLSSE    911 - 980
CHSKQELEADVSHKETKRKLVEAENSKSKRKKPNEYSKNLEKTNRKSEELSKRNNSSGIKLDSSKDSGTE    981 - 1050
DMLWTEKYQPQTASELIGNELAIKKLHSWLKDWKRRAELEERQNLKGKRDEKHEDFSGGIDFKGSSDDEE   1051 - 1120
ESRLCNTVLITGPTGVGKTAAVYACAQELGFKIFEVNASSQRSGRQILSQLKEATQSHQVDKQGVNSQKP   1121 - 1190
CFFNSYYIGKSPKKISSPKKVVTSPRKVPPPSPKSSGPKRALPPKTLANYFKVSPKPKNNEEIGMLLENN   1191 - 1260
KGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKR   1261 - 1330
PVILTTSDPTFSLMFDGCFEEIKFSTPSLLNVASYLQMICLTENFRTDVKDFVTLLTANTCDIRKSILYL   1331 - 1400
QFWIRSGGGVLEERPLTLYRGNSRNVQLVCSEHGLDNKIYPKNTKKKRVDLPKCDSGCAETLFGLKNIFS   1401 - 1470
PSEDLFSFLKHKITMKEEWHKFIQLLTEFQMRNVDFLYSNLEFILPLPVDTIPETKNFCGPSVTVDASAA   1471 - 1540
TKSMNCLARKHSEREQPLKKSQKKKQKKTLVILDDSDLFDTDLDFPDQSISLSSVSSSSNAEESKTGDEE   1541 - 1610
SKARDKGNNPETKKSIPCPPKTTAGKKCSALVSHCLNSLSEFMDNMSFLDALLTDVREQNKYGRNDFSWT   1611 - 1680
NGKVTSGLCDEFSLESNDGWTSQSSGELKAAAEALSFTKCSSAISKALETLNSCKKLGRDPTNDLTFYVS   1681 - 1750
QKRNNVYFSQSAANLDNAWKRISVIKSVFSSRSLLYVGNRQASIIEYLPTLRNICKTEKLKEQGKSKRRF   1751 - 1820
LHYFEGIHLDIPKETVNTLAADFP                                                 1821 - 1844
//

Publication (29)

PMID Year Title
25795125 Elg1, a central player in genome stability.
23937667 2013 Alternative replication factor C protein, Elg1, maintains chromosome stability by regulating PCNA levels on chromatin.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23277426 2013 ATAD5 regulates the lifespan of DNA replication factories by modulating PCNA level on the chromatin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21901109 2011 Predisposition to cancer caused by genetic and functional defects of mammalian Atad5.
21640107 2011 Dynamic regulation of PCNA ubiquitylation/deubiquitylation.
21555454 2011 The Brd4 extraterminal domain confers transcription activation independent of pTEFb by recruiting multiple proteins, including NSD3.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
More...