Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.82
PubTator Score 5.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.100 2.1e-02
adult high grade glioma -2.000 5.6e-03
astrocytic glioma -1.700 2.3e-03
Astrocytoma, Pilocytic -1.200 1.5e-02
Atopic dermatitis -1.100 4.0e-05
atypical teratoid / rhabdoid tumor -3.200 2.2e-06
cystic fibrosis 2.162 3.3e-07
ependymoma -3.300 1.9e-02
glioblastoma -1.500 9.7e-04
group 3 medulloblastoma -2.800 3.0e-03
interstitial cystitis 1.200 1.4e-02
lung carcinoma 1.600 6.4e-26
medulloblastoma, large-cell -1.100 1.4e-03
oligodendroglioma -1.400 6.2e-08
osteosarcoma 1.850 2.7e-03
pancreatic ductal adenocarcinoma liver m... -1.388 5.1e-03
Pick disease 1.400 5.0e-02
primitive neuroectodermal tumor -2.500 2.0e-02
psoriasis -1.100 7.9e-23
Rheumatoid arthritis 1.400 4.2e-02

Gene RIF (5)

AA Sequence

MSRKASENVEYTLRSLSSLMGERRRKQPEPDAASAAGECSLLAAAESSTSLQSAGAGGGGVGDLERAARR      1 - 70
QFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAGGA     71 - 140
LNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVT    141 - 210
INTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILS    211 - 280
QMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSAT    281 - 350
ILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSP    351 - 420
RITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFK    421 - 490
TEDIFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVS    491 - 560
LTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYI    561 - 630
RVKGSNYHLSDNDASDVE                                                        631 - 648
//

Text Mined References (18)

PMID Year Title