Property Summary

NCBI Gene PubMed Count 14
Grant Count 4
R01 Count 4
Funding $142,036.26
PubMed Score 10.53
PubTator Score 5.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.042
astrocytoma -1.900 0.000
posterior fossa group B ependymoma -4.000 0.000
glioblastoma -2.700 0.001
oligodendroglioma -1.400 0.000
osteosarcoma 1.850 0.003
group 3 medulloblastoma -4.500 0.000
cystic fibrosis 2.162 0.000
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -5.100 0.000
primitive neuroectodermal tumor -2.500 0.020
Atopic dermatitis -1.100 0.000
pancreatic ductal adenocarcinoma liver m... -1.388 0.005
interstitial cystitis 1.400 0.003
pediatric high grade glioma -2.000 0.002
pilocytic astrocytoma -1.200 0.015
acute myeloid leukemia -1.100 0.021
psoriasis -1.100 0.000
lung carcinoma 1.600 0.000
Pick disease 1.400 0.050

Gene RIF (5)

PMID Text
26094765 SLC2A13 is a novel gamma-secretase associated protein that regulates amyloid beta production without affecting Notch cleavage.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19607714 HMIT is primarily a neuronal transporter widely expressed in the rat and human brain, with particularly high levels in the hippocampus and cortex, as shown by immunohistochemistry.
19473719 genetic alterations of TSPAN14, SLC2A13 and PHF20 could play a role in non-small-cell lung cancer promotion
18976975 Knockdown of solute carrier family 2 (facilitated glucose transporter), member 13 (SLC2A13) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MSRKASENVEYTLRSLSSLMGERRRKQPEPDAASAAGECSLLAAAESSTSLQSAGAGGGGVGDLERAARR      1 - 70
QFQQDETPAFVYVVAVFSALGGFLFGYDTGVVSGAMLLLKRQLSLDALWQELLVSSTVGAAAVSALAGGA     71 - 140
LNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIAEVSPPNLRGRLVT    141 - 210
INTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVPAVIQFFGFLFLPESPRWLIQKGQTQKARRILS    211 - 280
QMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRRALIVGCGLQMFQQLSGINTIMYYSAT    281 - 350
ILQMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALIILALGFVLSAQVSP    351 - 420
RITFKPIAPSGQNATCTRYSYCNECMLDPDCGFCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFK    421 - 490
TEDIFWAYNFCPTPYSWTALLGLILYLVFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVS    491 - 560
LTFLHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYI    561 - 630
RVKGSNYHLSDNDASDVE                                                        631 - 648
//

Text Mined References (18)

PMID Year Title
26094765 2015 Proton myo-inositol cotransporter is a novel ?-secretase associated protein that regulates A? production without affecting Notch cleavage.
25642632 2015 Discovery of six new susceptibility loci and analysis of pleiotropic effects in leprosy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22451204 2012 Meta-analysis of Parkinson's disease: identification of a novel locus, RIT2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19915576 2009 Genome-wide association study identifies common variants at four loci as genetic risk factors for Parkinson's disease.
More...