Property Summary

NCBI Gene PubMed Count 35
PubMed Score 83.90
PubTator Score 66.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.357 2.8e-02
Multiple myeloma 1.557 9.2e-03
osteosarcoma 1.143 3.6e-03
hereditary spastic paraplegia -1.536 6.4e-03
pancreatic ductal adenocarcinoma liver m... -1.875 7.9e-03
subependymal giant cell astrocytoma -1.823 4.8e-02
ovarian cancer 1.700 2.1e-03
pituitary cancer -1.100 6.4e-04
Down syndrome 1.200 3.7e-03

Gene RIF (24)

PMID Text
27129276 In the absence of SLC1A5 there is a crucial role of SNAT1 in supplying glutamine for glutaminolysis with SNAT2 acting as a "backup" for glutamine transport.
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
26374858 Decreased placental mTOR activity causes down-regulation of placental system A activity by shifting SNAT-2 trafficking towards proteasomal degradation, thereby contributing to decreased fetal amino acid availability and restricted fetal growth in IUGR.
26041779 GADD34 promotes cell survival and adaptation to increased extracellular osmolarity by increasing the uptake of small neutral amino acids via the amino acid transporter SNAT2.
25653282 Increased availability of unsaturated fatty acids can compromise the stress-induced induction/adaptation in SNAT2 expression.
23728383 SNAT2 mRNA levels were significantly decreased in intrauterine growth-restricted placentas with reduced umbilical blood flows.
23408887 SLC38A1 and SLC38A2 transcript levels are altered in placental malaria with intervillositis.
22028413 Placental mRNA expression of system A transporter isoforms SLC38A1 and -2 was lower in teenagers than in adults which may underlie their susceptibility to delivering small-for-gestational-age infants.
21930789 findings show methylation status of rRNA differentially influenced the mechanism of 80S complex formation on IRES elements from SNAT2)versus the hepatitis C virus mRNA
21622135 Proteomic analysis of TAP-tag purified SNAT2 fusion proteins identified two novel SNAT2-interacting proteins that may potentially function in conjunction with SNAT2 transceptor to regulate signalling pathways influencing protein turnover and cell growth
20206993 Lower placental system A activity in women who reported strenuous exercise and had a lower arm muscle area may reflect an adaptation in placental function which protects maternal resources in those with lower nutrient reserves.
19741197 we have identified a novel regulatory pathway involving increased gene expression of the SNAT2 isoform mediated by a STAT-dependent pathway, which links IL-6 to increased activity of amino acid transporter system A
19589777 analysis of a conserved Na(+) binding site of the sodium-coupled neutral amino acid transporter 2
18703994 Report SNAT2 activity in fetal T lymphocytes in intrauterine growth restriction and with tumor necrosis factor-alpha treatment.
18697751 Despite increased ATF4 binding at the C/EBP-ATF composite site following activation of the unfolded protein response, system A transporter 2 (SNAT2) transcription activity is repressed
17237199 Therefore, we can speculate that such anion-conducting pathways are general features of Na+-transporting systems.
16621896 Results suggest that cortisol may be involved in upregulation of system A (SNAT2)in the placenta to ensure sufficient amino acid supply to the developing fetus.
16621798 SNAT2 expression can be modulated by specific signaling pathways in response to different stresses
16616430 The strong expression of Na(+)-coupled neutral amino acid transporter 2 in the somato-dendritic compartment and in non-neuronal elements that are integral parts of the blood-brain and brain-cerebrospinal fluid barrier.
16445384 deficient in the amino acid response pathway exhibited little or no induction of SNAT2 mRNA
16125834 Amino acid depletion was associated with an up-regulation of amino acid transport system A activity, largely mediated through an enhancement of SNAT2 expression at both the protein and mRNA level in BeWo cells.
15922329 Up-regulation of SNAT2 is essential for the rapid restoration of cell volume after hypertonic stress.
15581851 The synthesis of SNAT2 is required for the hypertonic stimulation of system A transport activity.
14623874 SNAT2 amino acid response element, along with a nearby conserved CAAT box, has enhancer activity and it confers regulated transcription to a heterologous promoter

AA Sequence

MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHPGT      1 - 70
TSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVHLLLKTANEGGSLLYEQLGYK     71 - 140
AFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQALTNIEDKTGLWYLNGNYLVLLVSLVVILPLS    141 - 210
LFRNLGYLGYTSGLSLLCMVFFLIVVICKKFQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDS    211 - 280
CRPHYFIFNSQTVYAVPILIFSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTF    281 - 350
YEHVESELLHTYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCASKDFSWWRHSLITVSI    351 - 420
LAFTNLLVIFVPTIRDIFGFIGASAASMLIFILPSAFYIKLVKKEPMKSVQKIGALFFLLSGVLVMTGSM    421 - 490
ALIVLDWVHNAPGGGH                                                          491 - 506
//

Text Mined References (44)

PMID Year Title
27129276 2016 Deletion of Amino Acid Transporter ASCT2 (SLC1A5) Reveals an Essential Role for Transporters SNAT1 (SLC38A1) and SNAT2 (SLC38A2) to Sustain Glutaminolysis in Cancer Cells.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
26374858 2015 Increased ubiquitination and reduced plasma membrane trafficking of placental amino acid transporter SNAT-2 in human IUGR.
26041779 2015 Coordinated Regulation of the Neutral Amino Acid Transporter SNAT2 and the Protein Phosphatase Subunit GADD34 Promotes Adaptation to Increased Extracellular Osmolarity.
25759021 2015 Regulation of glutamine carrier proteins by RNF5 determines breast cancer response to ER stress-inducing chemotherapies.
25653282 2015 Proteasomal modulation of cellular SNAT2 (SLC38A2) abundance and function by unsaturated fatty acid availability.
23728383 2013 SNAT2 expression and regulation in human growth-restricted placentas.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
23408887 2013 Plasmodium falciparum malaria elicits inflammatory responses that dysregulate placental amino acid transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22028413 2012 Effect of maternal age and growth on placental nutrient transport: potential mechanisms for teenagers' predisposition to small-for-gestational-age birth?
21930789 2011 Requirement of rRNA methylation for 80S ribosome assembly on a cohort of cellular internal ribosome entry sites.
21622135 2011 SNAT2 transceptor signalling via mTOR: a role in cell growth and proliferation?
21269460 2011 Initial characterization of the human central proteome.
20206993 2010 Maternal muscle mass may influence system A activity in human placenta.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19741197 2009 IL-6 stimulates system A amino acid transporter activity in trophoblast cells through STAT3 and increased expression of SNAT2.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19589777 2009 A conserved Na(+) binding site of the sodium-coupled neutral amino acid transporter 2 (SNAT2).
18703994 2009 Amino acid transport systems beta and A in fetal T lymphocytes in intrauterine growth restriction and with tumor necrosis factor-alpha treatment.
18697751 2008 Despite increased ATF4 binding at the C/EBP-ATF composite site following activation of the unfolded protein response, system A transporter 2 (SNAT2) transcription activity is repressed in HepG2 cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
17237199 2007 The sodium-coupled neutral amino acid transporter SNAT2 mediates an anion leak conductance that is differentially inhibited by transported substrates.
16621896 2006 Cortisol stimulates system A amino acid transport and SNAT2 expression in a human placental cell line (BeWo).
16621798 2006 Amino acid starvation induces the SNAT2 neutral amino acid transporter by a mechanism that involves eukaryotic initiation factor 2alpha phosphorylation and cap-independent translation.
16616430 2006 Localization of the Na(+)-coupled neutral amino acid transporter 2 in the cerebral cortex.
16445384 2006 Characterization of the amino acid response element within the human sodium-coupled neutral amino acid transporter 2 (SNAT2) System A transporter gene.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16125834 2006 Impact of forskolin and amino acid depletion upon System A activity and SNAT expression in BeWo cells.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15922329 2005 SNAT2 silencing prevents the osmotic induction of transport system A and hinders cell recovery from hypertonic stress.
15581851 2004 The synthesis of SNAT2 transporters is required for the hypertonic stimulation of system A transport activity.
15561425 2005 Immunohistochemical localization of the amino acid transporter SNAT2 in the rat brain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14623874 2004 Transcriptional control of the human sodium-coupled neutral amino acid transporter system A gene by amino acid availability is mediated by an intronic element.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12054432 2002 ATA2-mediated amino acid uptake following partial hepatectomy is regulated by redistribution to the plasma membrane.
10930503 2000 Primary structure, functional characteristics and tissue expression pattern of human ATA2, a subtype of amino acid transport system A.
10747860 2000 Cloning of an amino acid transporter with functional characteristics and tissue expression pattern identical to that of system A.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.