Property Summary

NCBI Gene PubMed Count 35
Grant Count 9
R01 Count 4
Funding $634,296.17
PubMed Score 83.90
PubTator Score 66.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Gene RIF (24)

PMID Text
27129276 In the absence of SLC1A5 there is a crucial role of SNAT1 in supplying glutamine for glutaminolysis with SNAT2 acting as a "backup" for glutamine transport.
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
26374858 Decreased placental mTOR activity causes down-regulation of placental system A activity by shifting SNAT-2 trafficking towards proteasomal degradation, thereby contributing to decreased fetal amino acid availability and restricted fetal growth in IUGR.
26041779 GADD34 promotes cell survival and adaptation to increased extracellular osmolarity by increasing the uptake of small neutral amino acids via the amino acid transporter SNAT2.
25653282 Increased availability of unsaturated fatty acids can compromise the stress-induced induction/adaptation in SNAT2 expression.
23728383 SNAT2 mRNA levels were significantly decreased in intrauterine growth-restricted placentas with reduced umbilical blood flows.
23408887 SLC38A1 and SLC38A2 transcript levels are altered in placental malaria with intervillositis.
22028413 Placental mRNA expression of system A transporter isoforms SLC38A1 and -2 was lower in teenagers than in adults which may underlie their susceptibility to delivering small-for-gestational-age infants.
21930789 findings show methylation status of rRNA differentially influenced the mechanism of 80S complex formation on IRES elements from SNAT2)versus the hepatitis C virus mRNA
21622135 Proteomic analysis of TAP-tag purified SNAT2 fusion proteins identified two novel SNAT2-interacting proteins that may potentially function in conjunction with SNAT2 transceptor to regulate signalling pathways influencing protein turnover and cell growth
More...

AA Sequence

MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHPGT      1 - 70
TSFGMSVFNLSNAIVGSGILGLSYAMANTGIALFIILLTFVSIFSLYSVHLLLKTANEGGSLLYEQLGYK     71 - 140
AFGLVGKLAASGSITMQNIGAMSSYLFIVKYELPLVIQALTNIEDKTGLWYLNGNYLVLLVSLVVILPLS    141 - 210
LFRNLGYLGYTSGLSLLCMVFFLIVVICKKFQVPCPVEAALIINETINTTLTQPTALVPALSHNVTENDS    211 - 280
CRPHYFIFNSQTVYAVPILIFSFVCHPAVLPIYEELKDRSRRRMMNVSKISFFAMFLMYLLAALFGYLTF    281 - 350
YEHVESELLHTYSSILGTDILLLIVRLAVLMAVTLTVPVVIFPIRSSVTHLLCASKDFSWWRHSLITVSI    351 - 420
LAFTNLLVIFVPTIRDIFGFIGASAASMLIFILPSAFYIKLVKKEPMKSVQKIGALFFLLSGVLVMTGSM    421 - 490
ALIVLDWVHNAPGGGH                                                          491 - 506
//

Publication (44)

PMID Year Title
27129276 2016 Deletion of Amino Acid Transporter ASCT2 (SLC1A5) Reveals an Essential Role for Transporters SNAT1 (SLC38A1) and SNAT2 (SLC38A2) to Sustain Glutaminolysis in Cancer Cells.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
26374858 2015 Increased ubiquitination and reduced plasma membrane trafficking of placental amino acid transporter SNAT-2 in human IUGR.
26041779 2015 Coordinated Regulation of the Neutral Amino Acid Transporter SNAT2 and the Protein Phosphatase Subunit GADD34 Promotes Adaptation to Increased Extracellular Osmolarity.
25759021 2015 Regulation of glutamine carrier proteins by RNF5 determines breast cancer response to ER stress-inducing chemotherapies.
25653282 2015 Proteasomal modulation of cellular SNAT2 (SLC38A2) abundance and function by unsaturated fatty acid availability.
23728383 2013 SNAT2 expression and regulation in human growth-restricted placentas.
23506890 Evolutionary origin of amino acid transporter families SLC32, SLC36 and SLC38 and physiological, pathological and therapeutic aspects.
23408887 2013 Plasmodium falciparum malaria elicits inflammatory responses that dysregulate placental amino acid transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...